SecReT4
Protein ID: 169647060
T4SS name [ID]VirB [457]
Gene symboltaxB
Locus tagpOU1115_051
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1115 (NC_010422)
Repliconplasmid pOU1115 [GenBank: NC_010422] [Browse all T4SS(s) in this replicon]
Location [Strand]41002..42843 [-]
ProductTaxB
Component typeVirD4
UniProt IDB1MU95
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.2e-143, Aligned region: 104..573
TraG-D_C [PF12696], Evalue: 3.5e-25, Aligned region: 418..536
TrwB_AAD_bind [PF10412], Evalue: 6.6e-19, Aligned region: 333..550
Protein Sequence: 613 a.a.     [Download]
>gi|169647060|ref|YP_001716160.1| TaxB [Salmonella enterica subsp. enterica serovar Dublin]
MIMSLKLPDKGQWAFIGLVMCLVTYYTGSVAVYFLNGKTPLYIWKNFDSMLLWRIITESNIRTDIRLTAI
PSLLSGMVSSLIVPVFIIWQLNKTDVALYGDAKFASDNDLRKSKLLKWEKENDTDILVGVYKGKYLWYTA
PDFVSLGAGTRAGKGAAIGIPNLLVRKHSLIALDPKQELWKITSKVREILLGNKVYLLDPFNSKTHQFNP
LFYIDLKAESGAKDLLKLIEILFPSYGMTGAEAYFNNLAGQYWTGLAKLLHFFINYEPPWLNEFGLKPVF
SIGSVVDLYSNIDRELILSKREELEGTNGLDENALYHLRDALTKIREYHETEDEQRSSIDGSFRKKMSLF
YLPTVRKCTDGNDFDLRQLRREDITVYVGVNAEDISLAYDFLNLFFNFVVEVTLRENPDFDPTLKHDCLM
FLDEFPSIGYMPIIKKGSGYIAGFKLKLLTIYQNISQLNEIYGIEGAKTLMSAHPCRIIYAVSEEDDAAK
ISEKLGYITTTSKSTSKSRGRSTSQGESESEARRALVLPQELGTLDFKEEFIILKGENPVKAEKALYYLD
PYFMDRLMKVSPKLASLTMELNKTEKIFGVKGLKYPSKEKMLSVGELESEVLL
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|169647022|ref|NC_010422.1|:c42843-41002 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1115, complete sequence
GTGATTATGTCTTTAAAACTCCCAGATAAAGGCCAGTGGGCTTTTATCGGTCTGGTTATGTGTCTCGTGA
CATATTATACTGGTTCTGTTGCTGTTTACTTCCTGAACGGAAAAACGCCGCTTTATATATGGAAAAATTT
TGATTCCATGCTCCTGTGGCGAATAATAACAGAGAGTAATATACGGACAGATATCAGGTTAACCGCTATC
CCCTCTCTTTTATCAGGTATGGTTTCGTCTCTCATCGTGCCTGTTTTTATTATCTGGCAACTGAATAAAA
CAGATGTTGCTCTTTATGGTGACGCGAAGTTTGCCAGTGATAATGATTTAAGAAAATCGAAACTTCTGAA
ATGGGAGAAAGAAAACGATACTGATATTCTCGTCGGGGTATATAAAGGTAAATACCTGTGGTATACCGCA
CCAGATTTTGTATCACTTGGCGCAGGAACCCGCGCAGGTAAAGGTGCCGCCATTGGTATCCCTAATCTTC
TGGTCAGAAAACACTCTCTGATTGCGTTAGATCCAAAACAGGAATTGTGGAAAATCACCAGTAAGGTGCG
TGAAATACTGCTGGGTAATAAAGTTTATCTGCTCGACCCTTTCAACAGTAAAACACACCAGTTTAATCCC
CTTTTCTATATTGATTTAAAAGCGGAGAGTGGGGCTAAGGATCTGCTTAAACTGATTGAAATTCTGTTTC
CGTCTTATGGCATGACAGGGGCAGAAGCGTACTTTAATAATCTTGCGGGTCAATACTGGACAGGACTGGC
TAAGTTGCTTCATTTCTTTATTAACTATGAGCCGCCCTGGCTTAATGAGTTCGGGCTTAAACCCGTTTTC
TCAATCGGTTCTGTCGTCGACTTGTACAGCAATATTGACCGGGAACTGATACTCAGTAAGCGGGAAGAAC
TGGAGGGAACAAACGGGCTTGATGAAAACGCGTTGTATCATTTGCGCGATGCCCTGACCAAAATCAGGGA
ATATCACGAAACGGAAGATGAACAGCGTTCAAGCATTGATGGTTCTTTCCGTAAGAAAATGAGCCTGTTT
TATCTCCCAACCGTTCGTAAATGTACTGATGGTAATGATTTCGATCTCCGTCAGTTGCGACGGGAAGATA
TCACTGTTTATGTCGGTGTTAATGCGGAAGATATATCACTGGCTTACGATTTTCTGAACCTGTTTTTCAA
CTTCGTTGTTGAAGTGACATTGCGTGAAAATCCTGATTTTGATCCCACCCTGAAACATGACTGTCTGATG
TTTCTTGATGAGTTCCCTTCGATTGGTTATATGCCAATTATTAAAAAGGGGTCAGGGTATATTGCAGGTT
TTAAACTTAAGCTTCTGACAATTTATCAGAATATCAGTCAGCTAAATGAAATCTATGGTATTGAGGGAGC
CAAAACGCTGATGAGTGCTCATCCATGCCGTATTATCTATGCTGTCAGCGAAGAGGACGATGCCGCGAAG
ATATCAGAAAAACTTGGGTATATTACTACTACCTCAAAGAGCACAAGCAAGAGCCGGGGACGCTCAACAT
CACAGGGCGAATCAGAAAGTGAAGCCCGAAGAGCTCTGGTGCTTCCACAGGAGCTGGGAACGCTGGACTT
TAAAGAAGAGTTTATCATCCTGAAGGGAGAGAACCCTGTTAAAGCAGAAAAGGCACTTTATTACCTTGAT
CCGTATTTTATGGACAGATTAATGAAGGTGAGTCCCAAACTGGCATCATTGACGATGGAACTAAATAAGA
CGGAAAAAATATTTGGTGTGAAAGGGCTTAAATATCCGTCAAAAGAAAAAATGCTCTCCGTAGGAGAGCT
GGAGTCTGAGGTTTTGCTATGA
 Primer design