SecReT4
Protein ID: 169833034
T4SS name [ID]Tra_Tn [658]
Gene symbol-
Locus tagSPH_1417
StrainStreptococcus pneumoniae Hungary19A-6
Repliconchromosome [GenBank: NC_010380] [Browse all T4SS(s) in this replicon]
Location [Strand]1315957..1316178 [-]
Producthypothetical protein
Component typeOrf19_Tn
UniProt IDB1IC91
KEGG IDspv:SPH_1417
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 73 a.a.     [Download]
>gi|169833034|ref|YP_001694726.1| hypothetical protein SPH_1417 [Streptococcus pneumoniae Hungary19A-6]
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLIIAIIAVGLVFNAAGVKDILLELFNRI
IGA
 
Nucleotide Sequence: 222 bp     [Download]
>gi|169832377|ref|NC_010380.1|:c1316178-1315957 Streptococcus pneumoniae Hungary19A-6, complete genome
ATGAATTTTGGACAAAACCTTTATAACTGGTTTCTATCAAACGCTCAATCACTGGTGCTTTTAGCAATCG
TTGTGATTGGCTTGTATCTTGGCTTCAAGCGTGAGTTTAGCAAACTGATTGGCTTTTTAATTATTGCGAT
TATTGCGGTTGGCTTAGTCTTCAACGCTGCTGGAGTAAAAGACATTTTACTAGAGCTATTCAATCGCATT
ATTGGTGCTTAA
 Primer design