SecReT4
Protein ID: 169833242
T4SS name [ID]Tra_Tn [658]
Gene symbol-
Locus tagSPH_1423
StrainStreptococcus pneumoniae Hungary19A-6
Repliconchromosome [GenBank: NC_010380] [Browse all T4SS(s) in this replicon]
Location [Strand]1320453..1321838 [-]
ProductDNA translocase FtsK
Component typeOrf21_Tn
UniProt IDB1IC96
KEGG IDspv:SPH_1423
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 1.5e-41, Aligned region: 187..365
AAA_10 [PF12846], Evalue: 4.4e-06, Aligned region: 222..259
DUF87 [PF01935], Evalue: 2.3e-05, Aligned region: 222..340
Protein Sequence: 461 a.a.     [Download]
>gi|169833242|ref|YP_001694731.1| ftsk/SpoIIIE family protein [Streptococcus pneumoniae Hungary19A-6]
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|169832377|ref|NC_010380.1|:c1321838-1320453 Streptococcus pneumoniae Hungary19A-6, complete genome
ATGAAACAGCGTGGTAAAAGGATTCGCCCATCTGGTAAAGATTTAGTCTTTCATTTTACGATAGCGTCAC
TCCTGCCTGTTTTCCTGCTGGTTGTCGGACTGTTTCATGTGAAGACAATCCAGCAGATCAACTGGCAGGA
TTTTAACCTATCACAAGCAGATAAGATTGACATTCCCTATTTAATTATCAGTTTCAGTGTCGCAATTCTT
ATCTGCTTGCTGGTAGCGTTTGTATTCAAACGGGTTCGCTATGATACGGTTAAACAACTTTACCACCGTC
AAAAACTGGCAAAGATGATACTTGAAAACAAGTGGTATGAATCTGAACAGGTCAAAACAGAGGGTTTCTT
TAAAGATAGTGCTGGTCGTACAAAGGAAAAGATAACCTACTTCCCTAAAATGTATTATCGACTTAAAAAT
GGCTTGATACAGATACGGGTGGAAATCACGCTGGGAAAATATCAAGACCAACTCTTACACTTGGAAAAGA
AATTAGAGAGTGGCTTGTACTGTGAGCTGACGGATAAAGAGTTAAAGGATTCCTATGTGGAATATACTTT
GCTCTATGACACCATAGCCAGTCGTATTTCTATTGATGAAGTAGAAGCTAAAGATGGTAAACTTCGCTTA
ATGAAAAACGTATGGTGGGAATATGATAAGCTCCCTCATATGTTGATTGCTGGTGGTACAGGTGGCGGTA
AAACTTACTTTATACTGACACTGATTGAAGCCTTGCTTCATACAGATTCAAAACTGTATATTCTTGACCC
GAAAAATGCTGATCTTGCGGACTTAGGTTCTGTGATGGCAAATGTCTACTATAGAAAAGAAGACTTGCTT
TCTTGCATTGAAACATTCTATGAAGAAATGATGAAACGTAGTGAGGAAATGAAGCAGATGAAGAACTATA
AGACTGGCAAAAATTATGCTTACTTAGGTCTCCCGGCACACTTCTTAATCTTTGATGAATACGTCGCTTT
CATGGAAATGCTGGGAACAAAAGAAAACACCGCAGTTATGAATAAGCTGAAACAGATTGTCATGTTAGGT
CGTCAAGCTGGCTTCTTTCTAATACTGGCTTGTCAACGTCCAGACGCAAAATATTTAGGCGACGGAATCC
GTGATCAGTTTAATTTCAGAGTGGCTTTAGGTCGTATGTCTGAAATGGGCTATGGCATGATGTTTGGCAG
TGACGTACAAAAGGATTTCTTCTTAAAGCGAATCAAAGGTCGTGGCTATGTTGATGTAGGAACAAGTGTC
ATATCAGAGTTTTATACTCCCCTTGTACCAAAAGGATATGATTTCTTGGAGGAAATTAAAAAGTTATCCA
ACAGCAGACAGTCCACGCAGGCGACGTGCGAAGCGGAAGTCGCAGGTGTGGACTGA
 Primer design