SecReT4
Protein ID: 169833250
T4SS name [ID]Tra_Tn [658]
Gene symbol-
Locus tagSPH_1412
StrainStreptococcus pneumoniae Hungary19A-6
Repliconchromosome [GenBank: NC_010380] [Browse all T4SS(s) in this replicon]
Location [Strand]1309253..1310254 [-]
ProductNLP/P60 family protein
Component typeOrf14_Tn
UniProt IDB1IC86
KEGG IDspv:SPH_1412
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 5.6e-61, Aligned region: 46..202
NLPC_P60 [PF00877], Evalue: 1.2e-31, Aligned region: 224..329
Protein Sequence: 333 a.a.     [Download]
>gi|169833250|ref|YP_001694721.1| NLP/P60 family protein [Streptococcus pneumoniae Hungary19A-6]
MKLKTLVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGVNVSAEVLAHKPMVEKYAKEYGIEEYV
NILLAIIQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLASSERLSVDLESVIQSYNYGG
GFLGYVANRGNKYTFELAQSFSKEYSGGEKVSYPNPIAIPINGGWRYNYGNMFYVQLVTQYLVTTEFDDD
TVQAIMDEALKYEGWRYVYGGASPTTSFDCSGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQAGDLV
FFHSTYNAGSYITHVGIYLGNNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|169832377|ref|NC_010380.1|:c1310254-1309253 Streptococcus pneumoniae Hungary19A-6, complete genome
ATGAAGTTGAAAACTTTAGTGATTGGTGGTTCTGGATTATTCTTGATGGTCTTCTCACTGCTTCTGTTTG
TTGCCATTTTATTTTCAGATGAACAGGACAGCGGAATTTCCAATATTCATTATGGAGGTGTGAATGTTTC
CGCAGAAGTGCTGGCTCATAAGCCTATGGTAGAAAAATATGCCAAAGAATATGGCATTGAAGAATATGTC
AACATACTTCTTGCGATTATACAGGTGGAATCGGGCGGTACTGCGGAAGATGTTATGCAGTCCTCGGAAT
CCCTCGGTCTTCCACCTAATTCATTGAGTACAGAAGAATCCATTAAGCAAGGTGTGAAGTATTTCAGTGA
ATTATTAGCCAGTAGCGAAAGGCTCAGTGTAGATTTAGAATCGGTTATCCAGTCCTACAATTATGGTGGT
GGTTTCTTAGGGTATGTGGCTAATCGTGGAAATAAATATACCTTTGAACTGGCTCAAAGTTTCTCAAAAG
AGTATTCAGGTGGCGAAAAAGTGTCTTACCCCAATCCCATAGCCATACCTATCAATGGGGGCTGGCGATA
CAACTATGGCAATATGTTTTATGTGCAACTGGTAACGCAGTATCTTGTCACAACAGAGTTTGATGATGAT
ACGGTACAAGCCATCATGGACGAAGCACTGAAATATGAGGGCTGGCGATACGTTTACGGTGGAGCTTCCC
CGACTACTTCTTTTGATTGTAGCGGACTGACACAATGGACGTATGGAAAAGCTGGAATTAACTTACCACG
AACCGCACAACAGCAATATGATGTGACCCAGCATATCCCACTATCGGAAGCACAAGCTGGCGATTTGGTT
TTCTTTCATTCTACCTATAACGCTGGCTCTTATATTACTCATGTTGGGATATACCTTGGCAATAACCGTA
TGTTTCATGCAGGCGACCCAATCGGTTATGCCGACTTAACAAGCCCCTACTGGCAACAGCATTTAGTGGG
AGCAGGACGAATCAAACAATGA
 Primer design