SecReT4
Protein ID: 169833648
T4SS name [ID]Tra_Tn [658]
Gene symbol-
Locus tagSPH_1415
StrainStreptococcus pneumoniae Hungary19A-6
Repliconchromosome [GenBank: NC_010380] [Browse all T4SS(s) in this replicon]
Location [Strand]1314862..1315368 [-]
Productconjugative transposon membrane protein
Component typeOrf17_Tn
UniProt IDB1IC89
KEGG IDspv:SPH_1415
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 2.6e-34, Aligned region: 44..145
Protein Sequence: 168 a.a.     [Download]
>gi|169833648|ref|YP_001694724.1| conjugative transposon membrane protein [Streptococcus pneumoniae Hungary19A-6]
MGFLKSSIKSVGTLLLADFLFYGVAQSATPIFYERIDYMKKIRSYTSIWSVEKVLYSINDFRLPFPITFT
QMTWFVVSLFAVMILGNLPPLSMIEGAFLKYFGIPVAFTWFMSTKTFDGKKPYGFLKSVIAYALRPKLTY
AGKKVTLGRNQPQEAITAVRSEFYGISN
 
Nucleotide Sequence: 507 bp     [Download]
>gi|169832377|ref|NC_010380.1|:c1315368-1314862 Streptococcus pneumoniae Hungary19A-6, complete genome
ATGGGATTTTTGAAATCGTCTATTAAATCTGTCGGTACATTACTACTGGCAGATTTTCTATTTTACGGGG
TGGCTCAATCAGCTACCCCTATTTTTTATGAAAGGATTGATTACATGAAGAAAATACGAAGCTATACCAG
TATCTGGTCTGTGGAAAAGGTACTGTATTCTATCAATGATTTTAGACTTCCGTTTCCCATAACCTTTACG
CAAATGACATGGTTTGTCGTGTCACTCTTTGCAGTGATGATACTTGGCAACTTGCCCCCTCTTTCCATGA
TAGAGGGAGCATTTCTCAAATACTTTGGGATTCCTGTGGCTTTCACATGGTTTATGTCTACAAAAACTTT
TGATGGTAAAAAGCCTTATGGATTTTTGAAGTCTGTCATTGCTTATGCACTGCGACCAAAGCTGACCTAT
GCAGGAAAAAAAGTAACGCTTGGCAGAAACCAGCCACAAGAAGCCATTACAGCAGTTAGGAGTGAATTTT
ATGGCATATCCAATTAA
 Primer design