SecReT4
Protein ID: 169833889
T4SS name [ID]Tra_Tn [658]
Gene symbol-
Locus tagSPH_1411
StrainStreptococcus pneumoniae Hungary19A-6
Repliconchromosome [GenBank: NC_010380] [Browse all T4SS(s) in this replicon]
Location [Strand]1308321..1309238 [-]
Productconjugative transposon protein
Component typeOrf13_Tn
UniProt IDB1IC85
KEGG IDspv:SPH_1411
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 9.6e-63, Aligned region: 78..304
Protein Sequence: 305 a.a.     [Download]
>gi|169833889|ref|YP_001694720.1| conjugative transposon protein [Streptococcus pneumoniae Hungary19A-6]
MMKFRKNQNKEKQIPKEKKPRVYYKVNPHKKVVIALWVLLGLSFSFAIFKHFTAIDTHTIHETTIIEKEY
VDTHHVENFVENFAKVYYSWEQSDKSIDNRMESLKGYLTDELQALNVDTVRKDIPVSSSVRGFQIWTVEP
TGDNEFNVTYSVDQLITEGENTKTVHSAYIVSVYVDGSGNMVLVKNPTITNIPKKSSYKPKAIESEGTVD
SITTNEINEFLTTFFKLYPTATASELSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLTVEYIDQ
QTKATQVSQFDLVLEKNGSNWKIIE
 
Nucleotide Sequence: 918 bp     [Download]
>gi|169832377|ref|NC_010380.1|:c1309238-1308321 Streptococcus pneumoniae Hungary19A-6, complete genome
ATGATGAAATTTAGAAAAAATCAGAATAAAGAAAAACAGATACCAAAGGAAAAGAAACCTCGTGTCTACT
ATAAGGTCAATCCTCATAAAAAGGTTGTGATTGCCTTGTGGGTACTTTTAGGGCTTAGTTTCAGCTTTGC
GATATTCAAGCACTTTACAGCTATAGATACTCATACTATTCACGAAACAACTATCATAGAAAAGGAATAC
GTTGATACTCATCATGTAGAAAATTTTGTAGAGAACTTTGCGAAAGTCTACTATTCATGGGAGCAATCCG
ATAAGTCCATTGATAATCGAATGGAAAGTCTAAAAGGCTATCTGACAGATGAACTTCAAGCTCTCAATGT
TGATACAGTACGCAAAGATATTCCTGTATCGTCTTCTGTAAGAGGATTTCAGATATGGACGGTAGAGCCA
ACTGGCGACAATGAGTTTAATGTAACCTACAGTGTAGACCAGCTCATTACAGAGGGAGAAAATACAAAGA
CCGTCCACTCTGCTTATATAGTGAGTGTCTATGTAGATGGTTCTGGAAATATGGTACTGGTTAAGAATCC
GACCATTACCAACATACCTAAGAAATCAAGTTATAAACCAAAAGCCATTGAAAGTGAGGGGACGGTTGAT
TCCATTACAACCAATGAAATCAATGAGTTTTTAACGACGTTCTTCAAGCTCTATCCTACAGCGACAGCCA
GTGAACTTTCCTACTATGTGAATGACGGGATATTAAAACCAATCGGAAAAGAGTACATCTTTCAAGAACT
GGTAAATCCTATTCACAATCGTAAGGATAATCAAGTCACGGTATCGCTGACAGTGGAGTATATCGACCAG
CAGACCAAAGCAACGCAGGTATCTCAATTTGATTTGGTACTTGAAAAGAACGGGAGTAATTGGAAGATTA
TAGAATAA
 Primer design