SecReT4
Protein ID: 170650820
T4SS name [ID]Tra_F [96]
Gene symboltraX
Locus tagEcSMS35_A0009
StrainEscherichia coli SMS-3-5
Repliconplasmid pSMS35_130 [GenBank: NC_010488] [Browse all T4SS(s) in this replicon]
Location [Strand]5088..5834 [-]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDB1LRJ0
KEGG IDecm:EcSMS35_A0009
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 7.5e-51, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|170650820|ref|YP_001739897.1| type IV secretion-like conjugative transfer system pilin acetylase TraX [Escherichia coli SMS-3-5]
MTTDNTNTTRNDSLVARTDTWLQSLLVWSPGQRDIIKTVALVLMVLDHANRILHLDQSWMFLAGRGAFPL
FALVWGLNLSRHAHIRQLAINRLWGWAVFSQFWYYFAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILMMALWGPLSGTSYGIAGLLMLAVSHRLYRAEDRMERLVLVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFPTFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|170650760|ref|NC_010488.1|:c5834-5088 Escherichia coli SMS-3-5 plasmid pSMS35_130, complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGTTGCCCGGACCGATACCTGGTTGCAGT
CGTTGCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTTCTGGA
CCATGCAAACCGTATTCTGCATCTGGACCAGTCGTGGATGTTTCTGGCCGGGCGCGGGGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACTGGCCATTAACCGGCTGT
GGGGATGGGCAGTTTTTTCCCAGTTCTGGTATTACTTTGCCGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACATGGTGTGAAACGCGCAGTGGGTGGCGTACTGCAGCG
GCCATTCTCATGATGGCACTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCTGTCAGCCACCGGCTGTACCGTGCGGAAGACAGAATGGAACGTCTGGTGCTTGTCGCTTGCCTGCT
GGCCGTGATTCCGGCGCTTAACCTTGCCACCAGTGATGCCGCGGCGGTGGCCGGCCTTGTGATGACGGTG
CTGACCGTTGGTCTGGTGTCCTGTGCAGGGAAATCATTACCCCGTTTCTGGCCCGGAGATTTTTTCCCGA
CGTTCTATGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGCTGTAA
 Primer design