SecReT4
Protein ID: 170650828
T4SS name [ID]Tra_F [96]
Gene symboltraF
Locus tagEcSMS35_A0020
StrainEscherichia coli SMS-3-5
Repliconplasmid pSMS35_130 [GenBank: NC_010488] [Browse all T4SS(s) in this replicon]
Location [Strand]20611..21354 [-]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDB1LRK1
KEGG IDecm:EcSMS35_A0020
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 8.6e-79, Aligned region: 23..237
Protein Sequence: 247 a.a.     [Download]
>gi|170650828|ref|YP_001739908.1| type IV secretion-like conjugative transfer system pilus assembly protein TraF [Escherichia coli SMS-3-5]
MNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQTATKRALYEAI
LYPGVDNFVKYFRLQNYWTQQAGLFTMSARKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKL
AEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMM
LVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 744 bp     [Download]
>gi|170650760|ref|NC_010488.1|:c21354-20611 Escherichia coli SMS-3-5 plasmid pSMS35_130, complete sequence
ATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGTCAGGAAAAGATGCAGGCT
GGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCTGTACCTGCAGCCCCCCGTCA
GGAACCGGATATTATGCAGAAACTGGCCGCACTGCAGACGGCAACAAAGCGGGCGCTGTACGAAGCCATT
CTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGCTGCAAAATTACTGGACTCAGCAGGCCGGGC
TTTTCACCATGAGCGCCAGAAAGGCCATGCTGGCACATCCTGAACTGGACTATAACCTGCAGTACAGCCA
TTACAACGGCACGGTACGGAACCAGCTGGCAGCAGACCAGGCGCAGCAGCGACAGGCCATTGCGAAACTG
GCTGAACACTACGGCATCATGTTTTTTTACCGGGGGCAGGACCCCATCGACGGGCAGCTGGCGCAGGTCA
TTAATGGCTTCCGGGATACCTATGGTCTGAGTGTTATTCCCGTTTCCGTGGATGGCGTGATTAATCCGCT
GTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGCGTGAAATATTTCCCGGCCATGATG
CTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCATACGGCTTTATTTCGCAGGACGACCTGGCAA
AACAATTCCTGAACGTTTCTGAAGATTTTAAACCCAATTTTTAA
 Primer design