SecReT4
Protein ID: 170650856
T4SS name [ID]Tra_F [96]
Gene symboltraL
Locus tagEcSMS35_A0038
StrainEscherichia coli SMS-3-5
Repliconplasmid pSMS35_130 [GenBank: NC_010488] [Browse all T4SS(s) in this replicon]
Location [Strand]34581..34892 [-]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDB1LRL9
KEGG IDecm:EcSMS35_A0038
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.3e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|170650856|ref|YP_001739926.1| type IV secretion-like conjugative transfer system protein TraL [Escherichia coli SMS-3-5]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|170650760|ref|NC_010488.1|:c34892-34581 Escherichia coli SMS-3-5 plasmid pSMS35_130, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design