SecReT4
Protein ID: 170650897
T4SS name [ID]Tra_F [96]
Gene symboltraQ
Locus tagEcSMS35_A0018
StrainEscherichia coli SMS-3-5
Repliconplasmid pSMS35_130 [GenBank: NC_010488] [Browse all T4SS(s) in this replicon]
Location [Strand]19845..20129 [-]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDB1LRJ9
KEGG IDecm:EcSMS35_A0018
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 2.3e-51, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|170650897|ref|YP_001739906.1| type IV secretion-like conjugative transfer system pilin chaperone TraQ [Escherichia coli SMS-3-5]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMEGQQEGRHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|170650760|ref|NC_010488.1|:c20129-19845 Escherichia coli SMS-3-5 plasmid pSMS35_130, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTTCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCAGACATGTCTCTC
ATTAA
 Primer design