SecReT4
Protein ID: 170717961
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1689
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1938541..1938984 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDB0UVG5
KEGG IDhsm:HSM_1689
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 4.7e-41, Aligned region: 25..141
Protein Sequence: 147 a.a.     [Download]
>gi|170717961|ref|YP_001785009.1| hypothetical protein HSM_1689 [Haemophilus somnus 2336]
MKVSRFLGYCSIVTGVFSPLAQAQPNIIVYTTKMYPIQNSQLASQIYYLDQVENFEESISRNLSKSPEIA
EQEMRAFFNSADWKAQEQQLKDAYQGVISGWQNGIKKVPAVFFDNPQSSPSVIYGTTDVQKALDEWHKWV
KQQGESK
 
Nucleotide Sequence: 444 bp     [Download]
>gi|170717206|ref|NC_010519.1|:1938541-1938984 Haemophilus somnus 2336 chromosome, complete genome
ATGAAAGTAAGTAGATTTCTGGGATATTGCAGTATAGTAACAGGTGTGTTTTCGCCCCTTGCACAAGCAC
AACCCAATATCATCGTCTATACCACAAAGATGTACCCTATTCAAAATTCACAACTTGCTTCCCAGATTTA
TTATCTTGACCAAGTAGAGAATTTTGAAGAGTCAATCAGTCGAAACCTCAGTAAATCACCAGAGATTGCC
GAACAAGAAATGCGTGCATTCTTTAATTCAGCAGATTGGAAAGCCCAAGAGCAACAATTAAAAGACGCTT
ATCAAGGCGTGATCAGTGGATGGCAAAATGGCATTAAGAAAGTACCTGCGGTGTTTTTTGATAATCCACA
ATCTTCTCCGAGTGTGATTTATGGTACGACTGACGTACAGAAAGCATTAGATGAATGGCATAAATGGGTT
AAACAACAAGGTGAATCAAAATGA
 Primer design