SecReT4
Protein ID: 170717963
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1690
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1938981..1939922 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDB0UVG6
KEGG IDhsm:HSM_1690
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 6.1e-95, Aligned region: 34..300
Protein Sequence: 313 a.a.     [Download]
>gi|170717963|ref|YP_001785010.1| hypothetical protein HSM_1690 [Haemophilus somnus 2336]
MKKTFLTILISASLAVPTTLYPQPARASLNTASIAASSASTSCLEYKVVGTCFWLFCTYFGCKVRTSTKI
KHYLPEMVVSSYNHDGQTPWTELQALNPGVKGGEYRSPQRQYSQLTFKNADAFGHPQGAIGQLLGNTGYY
CKTQTTPFMPYFLSGLDFFAWRENMPEMFYPEALTPGMREVGRVGDSWGNIYPRSGWVTQAHDYKASATI
VQRVADIVSRTAQPHIYFPAAKTGGAGEWPPGPVEEGQARTHKWQILYPQMSNTCSVFPNGGQTDTYSSQ
ISNQGDYAWALWRPYSCCKRRGQTFLYSIDWSH
 
Nucleotide Sequence: 942 bp     [Download]
>gi|170717206|ref|NC_010519.1|:1938981-1939922 Haemophilus somnus 2336 chromosome, complete genome
ATGAAAAAAACGTTTCTTACGATACTGATCTCTGCCAGTTTAGCTGTCCCAACAACCTTATATCCTCAAC
CAGCCAGAGCCTCATTGAATACCGCTTCCATTGCTGCATCAAGTGCCTCAACAAGCTGTTTGGAATATAA
AGTTGTTGGAACCTGTTTTTGGTTATTTTGTACCTACTTTGGATGTAAGGTTCGCACATCAACCAAAATT
AAGCATTATTTACCTGAAATGGTTGTTTCATCTTATAACCACGATGGGCAAACGCCATGGACAGAATTAC
AAGCTCTCAATCCTGGTGTAAAAGGTGGAGAATACCGTTCTCCACAACGCCAATACTCTCAACTCACTTT
CAAAAATGCGGATGCGTTTGGACACCCACAAGGAGCTATCGGTCAATTATTAGGAAATACGGGGTACTAT
TGTAAAACTCAAACTACGCCATTTATGCCTTACTTTTTGAGTGGGCTGGATTTTTTTGCCTGGCGTGAAA
ATATGCCGGAAATGTTTTACCCGGAAGCTCTGACTCCGGGAATGCGGGAAGTTGGCCGTGTAGGCGATAG
CTGGGGAAATATTTACCCACGTTCCGGTTGGGTAACCCAAGCACACGATTATAAAGCCTCTGCGACCATT
GTGCAGAGAGTGGCAGACATTGTGAGCCGAACAGCTCAGCCACACATTTATTTCCCAGCAGCCAAAACAG
GTGGTGCAGGAGAATGGCCTCCAGGACCGGTCGAAGAGGGACAAGCAAGAACACATAAATGGCAAATACT
TTACCCTCAAATGTCAAATACCTGCTCTGTTTTTCCTAATGGAGGGCAAACAGATACCTATTCTTCTCAA
ATTTCAAATCAAGGTGATTATGCTTGGGCATTATGGCGACCTTATAGTTGTTGCAAACGCCGTGGGCAAA
CATTCCTTTACAGTATTGATTGGTCACACTAA
 Primer design