SecReT4
Protein ID: 170717964
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1691
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1939940..1941952 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDB0UVG7
KEGG IDhsm:HSM_1691
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 670 a.a.     [Download]
>gi|170717964|ref|YP_001785011.1| hypothetical protein HSM_1691 [Haemophilus somnus 2336]
MKSHFNFKKSHLRITTALLSSVSGLSYADSITDKLEFSKSDSIISDRVFYQIGGGMGYMAPPSRGNTKVV
DLGIGWKANLTCGNFDIKTTIKNDLNGLKDGFKDLMGNVIDSAKGAVASMPAMVLQRANPQLYDLLTNGM
YQGKLDFNRLKTSCEEMSKVLADHTLGGKWGQAADLESYKQITSSQPDAKQAQKDLEDKKGKDGRVWIGG
QKKGGENQEAINVVGDVVKAGFNLLNKRNALDTSTISGSSCDGNLCQTWDNPQTAADFLTKIIGEQSIST
CKEDCGTKTSSKAGVGLSPEIEEEHVRTIVKLENVLNMDVPKAELLADLSSTTVPVTRGLIESLRDDPDV
EVLSQRLSAEIATSKIMEKMLLARRAVLAGMREPNVAQNADAQVELERVLNIIDREISQVKLEMDMQKMI
TGNTASVILQSKSEREALAGAHSLSQDSLDKRVQGLENGNVALTDLEAGSNINLSRRNIALSIPNIPNVA
ALIPNLPNRGGSGVGGNFPSLAQISGSTMDQATGLLRNFEGFISKAQWDVNAHRVGYGSDTITRADGTIV
KVTKDTVITKEDAERDLARRTAIFANNVRKELGDSNWNALPPNAQAVLVSYAYNYGSLAKTKSVLDAARR
SAQSGDMNALATAIRNRQVDNNGINARRRNQEADYILGKN
 
Nucleotide Sequence: 2013 bp     [Download]
>gi|170717206|ref|NC_010519.1|:1939940-1941952 Haemophilus somnus 2336 chromosome, complete genome
ATGAAATCTCACTTTAACTTCAAAAAATCCCACTTACGGATCACGACAGCATTATTATCAAGTGTATCAG
GACTATCTTATGCCGATTCGATTACGGATAAACTGGAATTTAGTAAGTCGGATTCGATTATTTCAGACCG
TGTTTTTTACCAAATCGGCGGTGGAATGGGTTATATGGCTCCACCTAGTCGTGGTAATACCAAAGTTGTT
GATTTAGGAATTGGTTGGAAAGCGAATTTAACCTGTGGTAATTTTGATATTAAAACGACCATTAAAAATG
ATTTAAACGGTCTCAAAGACGGCTTTAAAGATTTAATGGGGAATGTCATTGATTCAGCGAAAGGTGCGGT
TGCAAGTATGCCTGCAATGGTATTGCAACGGGCCAACCCTCAACTCTACGATTTACTCACAAATGGTATG
TACCAAGGTAAGCTGGATTTCAACCGTCTTAAAACCAGTTGTGAAGAAATGTCCAAAGTTTTAGCAGATC
ATACACTGGGAGGAAAATGGGGGCAAGCAGCTGATTTAGAAAGCTATAAGCAAATTACCTCCTCTCAACC
TGATGCAAAACAAGCTCAAAAAGACCTGGAAGATAAAAAAGGGAAAGATGGGCGAGTTTGGATAGGAGGT
CAGAAAAAAGGTGGGGAAAACCAAGAAGCTATCAATGTTGTTGGCGATGTTGTCAAAGCTGGGTTTAATT
TACTGAACAAACGTAATGCCTTAGATACCAGTACAATTTCAGGTTCAAGCTGTGATGGGAATCTTTGCCA
AACTTGGGATAATCCACAAACAGCAGCCGATTTTTTAACTAAGATTATTGGTGAACAATCTATTTCGACT
TGTAAAGAGGATTGTGGCACTAAAACCAGCTCAAAAGCCGGTGTAGGCTTGAGTCCGGAAATTGAGGAAG
AACATGTTCGTACTATTGTCAAATTAGAGAATGTACTGAATATGGATGTGCCTAAGGCTGAATTGTTAGC
TGATTTGAGTTCAACTACTGTACCAGTAACAAGAGGGCTTATTGAGAGTCTTCGAGATGATCCTGATGTT
GAGGTATTAAGCCAACGCTTATCTGCAGAAATTGCGACTAGTAAGATAATGGAAAAAATGCTCCTGGCTC
GGCGAGCAGTCTTAGCTGGTATGCGTGAGCCAAATGTCGCTCAAAATGCGGATGCACAAGTAGAACTGGA
AAGAGTACTCAATATTATTGACCGTGAAATTTCCCAAGTAAAACTAGAAATGGATATGCAAAAAATGATC
ACCGGCAATACGGCTTCGGTGATTTTGCAAAGCAAATCCGAACGAGAAGCTCTTGCTGGTGCTCATAGTT
TATCTCAAGACAGTCTGGATAAACGTGTTCAAGGACTTGAAAACGGTAATGTTGCATTAACTGATTTAGA
GGCAGGCTCTAATATTAACCTCTCTCGTAGAAATATTGCATTGAGTATCCCGAATATTCCGAATGTAGCT
GCTCTCATACCTAATCTGCCAAATCGAGGTGGTTCAGGTGTAGGTGGAAATTTCCCATCACTCGCACAAA
TCAGCGGTTCAACGATGGATCAAGCAACAGGATTACTACGTAATTTTGAAGGCTTTATCTCTAAGGCTCA
ATGGGATGTAAATGCTCATCGAGTAGGATATGGTTCCGATACAATTACCCGAGCTGATGGTACGATCGTA
AAAGTAACCAAAGATACGGTCATTACCAAAGAAGATGCAGAGCGTGATTTGGCCCGCCGAACAGCTATCT
TCGCAAATAATGTGAGAAAAGAGCTTGGAGATTCAAATTGGAATGCGTTACCGCCGAACGCTCAAGCTGT
TTTAGTGTCTTATGCATATAATTATGGTTCACTTGCTAAAACAAAAAGCGTACTTGATGCAGCCAGAAGA
TCAGCTCAAAGTGGTGATATGAATGCTTTAGCTACTGCAATCAGAAATCGCCAAGTTGATAATAATGGCA
TCAATGCACGTCGCCGGAATCAGGAAGCTGACTATATTCTCGGTAAAAATTAA
 Primer design