SecReT4
Protein ID: 170717965
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1692
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1941973..1942401 [+]
Producthypothetical protein
Component typeTfc21
UniProt IDB0UVG8
KEGG IDhsm:HSM_1692
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|170717965|ref|YP_001785012.1| hypothetical protein HSM_1692 [Haemophilus somnus 2336]
MRKLLGITVLTLCTTSAFATDKNVVFSCTSTEGKPLTVKRVGNDYEYSYDKTIFKNPIKKAVTNDGSIIA
RGSGFTTYALELKNDGLKYVVGFVQPNGNSKEFIEPGATISRDNDQPSIGSVDCDPYKKIYYKFDVHLMN
TL
 
Nucleotide Sequence: 429 bp     [Download]
>gi|170717206|ref|NC_010519.1|:1941973-1942401 Haemophilus somnus 2336 chromosome, complete genome
ATGCGTAAATTATTAGGTATTACTGTACTTACACTTTGTACAACTTCAGCATTTGCAACGGATAAAAATG
TGGTATTTTCTTGTACCAGCACAGAAGGTAAACCTCTCACAGTTAAACGGGTAGGAAATGATTACGAGTA
TTCGTATGATAAAACTATCTTCAAAAACCCAATCAAAAAAGCGGTGACCAACGATGGCTCAATTATCGCT
AGAGGATCAGGTTTTACCACGTATGCATTAGAACTGAAAAATGATGGTTTGAAGTATGTAGTTGGGTTTG
TTCAACCAAATGGTAACTCAAAAGAGTTTATTGAGCCTGGAGCAACGATTAGCCGTGATAATGATCAACC
AAGCATTGGCTCTGTAGATTGTGATCCTTACAAAAAAATCTATTATAAGTTTGATGTTCATTTAATGAAT
ACCTTGTAA
 Primer design