SecReT4
Protein ID: 170717967
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1694
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1943108..1943449 [+]
Producthypothetical protein
Component typeTfc20
UniProt IDB0UVR3
KEGG IDhsm:HSM_1694
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 113 a.a.     [Download]
>gi|170717967|ref|YP_001785014.1| hypothetical protein HSM_1694 [Haemophilus somnus 2336]
MKFIDFGKQLANPVKFIKQNTAFLPKPIQQVVVFAVIFAGLPLFILGFFILRIWAYKHISLYSEYKDMAN
SEISSKDTDLKSLFSDDEEQEDDEYQYGYDGPGIYLGNYRVDE
 
Nucleotide Sequence: 342 bp     [Download]
>gi|170717206|ref|NC_010519.1|:1943108-1943449 Haemophilus somnus 2336 chromosome, complete genome
ATGAAATTTATCGATTTCGGAAAGCAGCTCGCTAACCCAGTTAAATTTATCAAACAGAATACTGCATTTT
TACCTAAGCCTATTCAACAAGTGGTCGTTTTTGCGGTAATTTTTGCAGGATTGCCTCTATTTATCTTGGG
TTTCTTTATTCTCAGAATATGGGCTTATAAGCATATTTCTTTGTATAGTGAATATAAAGATATGGCTAAT
TCAGAAATATCGTCTAAAGATACAGATTTAAAATCACTTTTTTCTGATGATGAAGAACAAGAAGATGATG
AATATCAATATGGGTATGATGGACCAGGTATATATCTAGGTAATTACCGTGTTGATGAGTAA
 Primer design