SecReT4
Protein ID: 170717968
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1695
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1943495..1944967 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDB0UVR4
KEGG IDhsm:HSM_1695
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4.9e-109, Aligned region: 10..483
Protein Sequence: 490 a.a.     [Download]
>gi|170717968|ref|YP_001785015.1| hypothetical protein HSM_1695 [Haemophilus somnus 2336]
MTFTVDSYLEYFLTLLAWIINNNIFAVLVQTGLFVLPLIFVLISTWMEVKKQGEDEGNKGDLLITWLSLK
FYPAMFVVVLVLAPMIPINLNNIELNVERSKACGYRVPTAPEDSGYNQMNSELGDQQARVPIWWGLFHQI
NKGVTHALTASIPCKPDLRQVRFEVQHEKINNPALLTEVRLFVQQCYVPARQKIQNSQLSLSPAQVRETS
WLGGRILIANSELYPRYRAQQPHSLFPYNASRDNGLPNNGEGGFPNCAEWWDTANNGLKDRLLDDVKQNF
SAKVIDFFSSKENSDESILRTVLRAENMDISRGKVYPGYGGNLDRSFTNEVTKTASMFGLSLGSIGAFPA
FDSMRQALPMVHSFALMALIILTPLIMVMSGYSLKTLVTLTFVNFALVTLTFWWELARWLDSWLLSVLYD
SGTHSRINPYFLENTQDDIIVNFVMGSMFLVLPAIWLGSMSWVGVKMGEFASHLTTGSRDSKTAGSKIGK
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1944967-1943495 Haemophilus somnus 2336 chromosome, complete genome
ATGACCTTTACCGTAGATAGTTACTTAGAATACTTTCTTACCTTACTGGCTTGGATCATCAACAACAATA
TTTTCGCTGTATTGGTTCAAACAGGGTTGTTTGTTCTGCCTCTCATTTTTGTCTTAATCAGTACGTGGAT
GGAAGTCAAAAAACAAGGTGAGGACGAAGGTAATAAAGGGGATTTACTTATTACTTGGCTCAGCCTCAAA
TTTTACCCGGCGATGTTTGTCGTTGTATTGGTCTTAGCTCCAATGATACCGATCAACCTGAATAATATTG
AGTTGAATGTAGAACGTTCTAAAGCCTGTGGTTATCGTGTTCCAACTGCACCAGAGGATAGTGGTTATAA
CCAAATGAACTCTGAATTGGGTGATCAACAAGCGAGAGTCCCTATCTGGTGGGGATTATTTCATCAAATC
AACAAAGGGGTAACACACGCCTTAACAGCTTCAATTCCCTGCAAACCGGATTTACGTCAAGTTCGTTTTG
AAGTTCAACACGAGAAAATCAATAATCCAGCATTATTGACAGAGGTTCGCTTATTTGTACAACAATGCTA
TGTACCGGCACGTCAGAAAATTCAAAATAGCCAACTTTCATTGAGCCCAGCACAGGTTCGTGAGACTAGC
TGGTTAGGTGGCCGTATTTTGATTGCAAATAGCGAGCTTTATCCCCGTTATCGAGCCCAACAACCTCATA
GTCTATTTCCCTATAATGCTTCTCGGGATAATGGATTGCCGAATAATGGAGAGGGTGGTTTTCCAAATTG
TGCAGAGTGGTGGGATACGGCGAATAATGGTTTAAAAGATCGTTTATTAGATGATGTAAAACAGAACTTC
TCTGCAAAAGTGATTGATTTTTTCAGCAGTAAAGAAAATTCCGATGAATCCATACTTCGTACCGTATTAC
GAGCTGAGAATATGGATATTTCGAGAGGGAAAGTTTATCCCGGGTATGGGGGAAATTTAGACAGATCATT
TACAAATGAAGTGACTAAAACAGCTTCAATGTTTGGTCTGTCATTAGGCAGTATCGGAGCATTCCCTGCT
TTTGATTCGATGCGGCAAGCATTACCGATGGTGCATTCATTTGCATTAATGGCATTGATTATTCTCACGC
CTTTAATTATGGTTATGAGTGGTTATTCGTTAAAAACATTGGTTACGCTAACTTTTGTGAATTTCGCATT
AGTTACACTCACATTTTGGTGGGAACTAGCTAGATGGCTTGACTCTTGGTTGCTGTCGGTCCTCTATGAT
TCAGGCACACATAGCAGAATAAACCCTTATTTCCTTGAAAATACACAAGACGATATTATTGTGAATTTTG
TGATGGGTTCTATGTTCTTGGTCTTACCAGCGATTTGGCTAGGCAGTATGTCTTGGGTAGGAGTAAAAAT
GGGAGAGTTTGCAAGTCATTTAACTACTGGTTCTAGAGACTCTAAAACAGCGGGTTCCAAGATAGGGAAA
TAA
 Primer design