SecReT4
Protein ID: 170717969
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1696
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1944978..1945295 [-]
Producthypothetical protein
Component typeTfc18
UniProt IDB0UVR5
KEGG IDhsm:HSM_1696
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 105 a.a.     [Download]
>gi|170717969|ref|YP_001785016.1| hypothetical protein HSM_1696 [Haemophilus somnus 2336]
MKSDTTKPKMTRVITVLKITLMIIGIILLLLVVGWLAMTYFPSTNFQAWFYETRYAWLGWRFVLYVAIWL
LMVQLNRKGQMPLKARLMILSVIPIIEGLNLLYLL
 
Nucleotide Sequence: 318 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1945295-1944978 Haemophilus somnus 2336 chromosome, complete genome
ATGAAGTCTGATACAACAAAGCCTAAAATGACAAGGGTTATTACTGTATTAAAAATAACCTTGATGATCA
TCGGTATTATTTTATTACTACTCGTTGTTGGCTGGTTGGCAATGACCTATTTTCCTTCCACAAATTTTCA
AGCGTGGTTCTATGAAACCCGCTATGCCTGGTTGGGATGGCGATTTGTTTTATATGTAGCTATTTGGCTA
TTGATGGTACAACTTAATCGAAAAGGGCAAATGCCATTAAAAGCCAGGTTAATGATTTTATCTGTCATCC
CAATTATTGAGGGACTTAATTTACTGTATCTACTTTAA
 Primer design