SecReT4
Protein ID: 170717970
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1697
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1945285..1945713 [-]
Producthypothetical protein
Component typeTfc17
UniProt IDB0UVR6
KEGG IDhsm:HSM_1697
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|170717970|ref|YP_001785017.1| hypothetical protein HSM_1697 [Haemophilus somnus 2336]
MNKQHYRLFNAGPQKSSLGVVSPAVETQLLGFCEQIRQLIGVGKQITLFPHRVVQNHWAIELSGEQGSVH
LLLNVTGRSLLPTSNNSEWSARLIIEIADHVDAYWFSAFLTQYLGLKSNLLPLSTSIADNSVYNEVIDNN
EV
 
Nucleotide Sequence: 429 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1945713-1945285 Haemophilus somnus 2336 chromosome, complete genome
ATGAATAAACAACATTACCGTTTATTTAATGCAGGCCCACAAAAATCCTCATTAGGAGTTGTATCTCCAG
CGGTAGAAACTCAATTGCTTGGATTTTGTGAACAAATTCGCCAACTCATCGGCGTTGGGAAACAGATTAC
CTTATTCCCTCATCGTGTCGTGCAAAATCACTGGGCTATCGAACTTTCTGGTGAGCAGGGTTCTGTTCAC
TTATTACTTAATGTGACGGGGCGTTCTTTGCTACCAACTTCCAATAACAGTGAATGGTCAGCTCGTTTAA
TTATTGAAATAGCTGATCATGTGGATGCTTATTGGTTTTCGGCATTCCTTACTCAGTATCTCGGTTTGAA
AAGTAATCTTTTACCCTTATCCACATCAATTGCGGATAACTCTGTGTATAACGAGGTAATAGATAATAAT
GAAGTCTGA
 Primer design