SecReT4
Protein ID: 170717971
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1698
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1945713..1948550 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDB0UVR7
KEGG IDhsm:HSM_1698
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2.1e-61, Aligned region: 66..336
AAA_10 [PF12846], Evalue: 2.1e-37, Aligned region: 530..865
Protein Sequence: 945 a.a.     [Download]
>gi|170717971|ref|YP_001785018.1| hypothetical protein HSM_1698 [Haemophilus somnus 2336]
MSFLSEVFSSFKPTKAGVISSEPNENTGESDIIQNKMSEVNNEVQQLKRSGKLTQSQHHRRLYSQEPSFI
DHLPWGEYLNEHGVILLDDARSVGAVFDIKPIGTAGRSIEFLSRIRNLVKDALQDSFDELDVNPYVVQFY
CQDSDDLQPYIEQLRNYISPIAKNSAFSEEWLRVQAKHFKDIGKPEGLFIDERVTNTAWSGRIRSTKMVI
YRYVDKSNDTNENLIVEQLNNACSRINGALTTAGLQLQRLDGEQFRQWLLRWFNPNPSINFEGLSNNDCY
HLFGKQTSNDGLPELAFNDFSEDLFYSQPKNEGNYWYFDDQPHEVVVVNNLRKQPEVGLMTGEITRGRNI
NALFDLLPESTIMAITIVIHPQDKLEAHLEKISSRAVGENFESKYLKEDCQTVQSYLKEGHKLYQAAIAF
YVRGKDEKELRTRSRQLRTILLSNNLEPVKENAEIAPLNSYLRWLPMNFNPQMDAKSHYYTKYYFVQHLA
NLLPIFGRDTGTGNPGITYFNRGGAPFNFDPFNRKDRTKNAHKLLLGPTGSGKSATLCGQLCQAMAVYRP
RTFVVEAGNSFGLLADYAERFGLTVNRITLAPNSGIVLPLFSEAHRLLDMELNPEDVPEDIEDNDDTDDE
GDMQRDLLAEMELTARLMITGGEKKEDEKMSRADRAAIRRAILNAARQTKSEGRQTLTEDIKNALEALSH
DEHTREERRTRLAEMAESLEMFCTGVNGQFFNREGAIWPEADLTLVDLAMFAREGYEAELAISYISLINH
INSLGEKYQHSDRMILNVTDESHIITANPLLAKFLVKGSKMWRKLGIWLWLATQNMDDFPNEAAKLLSMV
EWWELLNVSASEIDEINRFRKLSEAQKTMLLSAKKSDRKYTEGVVLATNMEALFRVVPPSLFLALGMTEK
HEKAERKQLMMQHGYTELDAALEVAARIDKARGIH
 
Nucleotide Sequence: 2838 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1948550-1945713 Haemophilus somnus 2336 chromosome, complete genome
ATGTCTTTTTTAAGTGAGGTATTTTCCTCTTTCAAACCGACTAAAGCAGGGGTTATATCAAGTGAACCAA
ATGAAAATACCGGTGAGTCTGACATCATTCAAAATAAAATGAGTGAGGTAAATAACGAGGTTCAACAATT
AAAACGCAGTGGAAAACTCACCCAGTCACAGCATCACCGTCGGTTATACTCACAAGAGCCCTCCTTTATC
GATCATCTACCTTGGGGAGAATATTTGAATGAGCACGGTGTGATACTCCTTGATGATGCCCGTAGTGTTG
GGGCAGTATTTGATATTAAGCCGATTGGTACTGCTGGCCGTAGTATTGAATTTTTAAGTCGGATACGTAA
TCTTGTCAAAGATGCCTTGCAAGACAGCTTTGATGAATTGGATGTAAATCCGTACGTTGTTCAATTTTAT
TGCCAAGACAGCGATGATTTACAGCCTTATATTGAACAGCTACGAAATTATATCTCGCCTATCGCTAAAA
ATAGTGCATTTAGCGAAGAATGGTTACGGGTACAAGCCAAGCATTTCAAGGATATCGGTAAACCAGAGGG
GCTTTTTATTGATGAGCGAGTGACAAATACAGCTTGGTCTGGTCGTATACGTAGTACCAAAATGGTGATC
TATCGGTATGTTGATAAATCCAATGACACTAATGAAAATCTGATTGTCGAGCAGCTGAACAATGCTTGTT
CTCGCATAAATGGAGCTCTAACAACTGCTGGATTACAATTGCAGCGACTGGATGGCGAACAATTTCGTCA
ATGGCTGTTACGTTGGTTTAATCCCAATCCTTCTATTAATTTTGAGGGGTTAAGCAACAATGATTGCTAC
CATCTCTTTGGTAAACAAACCTCAAATGACGGGCTTCCAGAATTAGCGTTTAACGATTTCAGTGAAGATT
TATTTTATTCTCAACCGAAAAATGAAGGCAACTATTGGTATTTTGATGACCAACCGCACGAAGTTGTTGT
AGTCAATAATTTGAGGAAACAACCGGAAGTGGGGTTGATGACTGGCGAGATTACTCGTGGGCGTAATATC
AATGCATTATTTGACTTGTTGCCGGAATCAACCATTATGGCAATTACCATCGTCATCCATCCACAGGATA
AGTTGGAGGCACATTTAGAAAAAATTAGTAGTCGAGCGGTAGGTGAAAATTTTGAGTCGAAATACCTAAA
AGAAGACTGTCAAACTGTACAGTCTTATCTTAAAGAGGGGCATAAACTCTATCAAGCAGCTATTGCATTT
TACGTTCGAGGTAAGGATGAAAAGGAGCTACGTACCCGTTCTCGCCAGTTGAGAACGATTCTGCTCAGTA
ACAACCTAGAACCCGTGAAGGAAAATGCAGAAATTGCCCCACTTAACAGCTATTTGCGTTGGCTACCAAT
GAATTTTAATCCGCAGATGGATGCCAAATCACATTACTACACGAAGTACTATTTTGTACAACATTTGGCA
AACTTATTACCTATCTTTGGCCGAGATACCGGGACTGGGAATCCGGGGATCACTTACTTTAATCGAGGAG
GAGCACCATTTAATTTCGACCCATTTAACCGTAAAGACAGAACCAAAAATGCTCACAAGCTATTATTAGG
TCCAACCGGTTCGGGAAAATCAGCTACGTTATGTGGGCAATTATGTCAGGCTATGGCCGTTTATCGCCCA
CGGACTTTTGTTGTTGAGGCAGGAAATTCATTTGGTTTATTAGCGGACTATGCAGAACGTTTCGGACTGA
CTGTAAATCGCATTACGTTAGCTCCAAACAGCGGCATTGTCTTACCACTCTTTTCAGAAGCACATCGTCT
ATTGGATATGGAATTAAACCCGGAAGATGTGCCGGAAGACATTGAGGATAACGATGACACTGATGATGAA
GGTGATATGCAACGAGATTTATTGGCCGAAATGGAGCTGACGGCACGTTTGATGATCACCGGAGGTGAAA
AGAAAGAAGATGAAAAAATGAGCCGTGCTGATCGTGCTGCTATTCGTCGTGCCATTTTAAATGCAGCTCG
CCAAACCAAATCTGAAGGCAGACAAACGCTGACTGAAGATATTAAAAATGCTTTGGAAGCATTAAGTCAT
GATGAGCATACTCGTGAAGAACGGCGTACCCGTTTAGCAGAAATGGCAGAATCATTAGAAATGTTTTGTA
CCGGTGTAAATGGGCAATTTTTTAATCGAGAGGGGGCAATTTGGCCGGAGGCTGATCTAACCTTAGTTGA
TTTAGCTATGTTTGCCCGGGAAGGCTATGAAGCAGAGTTGGCCATTTCCTATATTTCACTCATTAACCAT
ATCAACAGTCTTGGTGAAAAATACCAACACAGTGATCGGATGATTCTGAATGTAACAGATGAATCACACA
TTATCACGGCCAACCCATTATTAGCTAAATTCCTAGTTAAAGGCTCAAAAATGTGGCGTAAACTAGGGAT
TTGGCTATGGCTTGCTACTCAAAATATGGATGACTTCCCGAATGAAGCGGCGAAATTACTCTCAATGGTC
GAATGGTGGGAATTGTTGAATGTGTCTGCCAGTGAAATTGATGAAATCAATCGTTTCCGGAAACTGTCAG
AGGCCCAGAAAACGATGTTGTTATCTGCCAAAAAATCAGATCGTAAATATACCGAGGGCGTGGTATTAGC
AACGAATATGGAAGCTCTATTCCGAGTTGTACCGCCTAGCTTATTTTTAGCTTTAGGAATGACTGAAAAA
CATGAAAAAGCAGAACGTAAGCAACTGATGATGCAGCACGGCTATACCGAACTCGATGCAGCTTTAGAGG
TTGCAGCTCGGATTGATAAAGCAAGAGGAATACACTAA
 Primer design