SecReT4
Protein ID: 170717972
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1699
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1948553..1948951 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDB0UVR8
KEGG IDhsm:HSM_1699
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 132 a.a.     [Download]
>gi|170717972|ref|YP_001785019.1| hypothetical protein HSM_1699 [Haemophilus somnus 2336]
MKHLFCIMISALLITGCTTSTEELLPTNGSTMRDIWDKGASNNDLHLYRSQQGRTLDPVDYIPNSEQRAY
TRTAENEINNLFPRLPNPDLIMYVYPHQTRSGEPLSIPGYSTVLPFYGRVQYAQPGDRTRGL
 
Nucleotide Sequence: 399 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1948951-1948553 Haemophilus somnus 2336 chromosome, complete genome
ATGAAACATTTATTTTGCATAATGATAAGTGCCTTATTGATAACAGGTTGCACAACATCAACAGAAGAAT
TATTACCTACTAACGGCAGTACGATGCGGGATATTTGGGATAAAGGAGCGAGTAATAACGATCTACACTT
ATACCGTTCACAACAAGGGCGAACACTTGACCCTGTCGATTATATTCCTAATAGTGAGCAACGAGCCTAT
ACCCGTACGGCAGAAAATGAAATTAATAACTTGTTCCCTCGTTTACCTAATCCGGATCTGATTATGTATG
TGTACCCACATCAAACTCGTTCCGGAGAGCCTCTCAGTATTCCAGGATATTCTACAGTACTACCTTTCTA
TGGACGAGTTCAATATGCTCAGCCGGGTGATAGAACAAGAGGGCTTTAA
 Primer design