SecReT4
Protein ID: 170717975
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1700
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1948964..1950418 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDB0UVR9
KEGG IDhsm:HSM_1700
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 484 a.a.     [Download]
>gi|170717975|ref|YP_001785020.1| hypothetical protein HSM_1700 [Haemophilus somnus 2336]
MKANKALFVILGIVFILVGGIVYALFGRSESVPQPTQQEILDISIKDLTPEQVRTMGIQGDTPIDTLRTL
VTTVKSNERRMDELIDENRQLKQKEDLVNGRINDAVNNETRKLQEQIADLKMQLFDMATLVNNKPTTQES
TPQVEAQPNTVPNKGFGTAGDKLPIGGATMSNVDTSGMYWVEPSDQISLDASGKPVSGNTVATKFGFPKD
FNGGQSAGNNEKKGLPFFPETDTVTSSQGTAGNARGKNQMTSVYTIPSNSTFLDSVAMTGLIGRIPIDNR
VSDAYPFKVLIGRENLIANGIELPDVDGAIVSGTATGDWTLSCVRGSVKSMTFVFNDGRIVSTSNKGNGE
EIGWLSDSSGIPCVPGERKTNAPEYLGTNFFLAAASAAAQGFSQSQTTTVVDGSSVVGAVTGDQGKFILG
QAIGGGLKESADWFRKRFAENFDAVYVPPGHRVSIHIEKEIEIDYNAQGRKVKYGSKSTNSQLD
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1950418-1948964 Haemophilus somnus 2336 chromosome, complete genome
ATGAAAGCGAATAAAGCCTTATTTGTCATACTGGGCATTGTATTTATCTTAGTCGGTGGAATTGTCTATG
CCTTATTTGGACGTAGTGAGTCAGTTCCACAACCGACACAACAGGAAATTTTAGATATTTCCATTAAAGA
TTTAACACCTGAACAAGTCAGAACAATGGGTATTCAAGGTGATACGCCGATTGATACGCTGCGTACCCTT
GTGACAACCGTTAAATCCAATGAGCGTCGTATGGATGAGTTAATTGATGAAAATCGCCAACTCAAACAGA
AAGAAGATTTAGTGAATGGTCGTATCAATGATGCGGTAAATAATGAAACCCGAAAACTGCAAGAGCAGAT
TGCAGATTTGAAAATGCAATTATTTGATATGGCGACTCTCGTTAATAACAAACCAACAACACAAGAGTCT
ACCCCTCAGGTAGAGGCTCAGCCTAATACGGTACCGAATAAAGGATTTGGAACAGCAGGAGATAAATTAC
CTATCGGTGGTGCAACTATGTCCAACGTGGATACCAGTGGAATGTATTGGGTAGAACCAAGCGATCAGAT
TAGTTTGGATGCAAGTGGAAAACCTGTGTCAGGCAATACAGTAGCAACTAAATTTGGCTTTCCGAAAGAT
TTTAATGGAGGACAATCTGCAGGAAATAACGAAAAGAAAGGTCTGCCGTTTTTCCCGGAAACAGATACTG
TGACAAGCTCACAAGGAACGGCTGGAAACGCACGTGGTAAAAACCAGATGACATCAGTATATACCATACC
AAGTAATTCAACATTCCTTGATTCAGTTGCAATGACGGGACTCATCGGACGTATCCCGATTGATAATCGA
GTATCGGATGCTTATCCGTTCAAAGTACTTATTGGTCGAGAAAATCTCATTGCTAATGGTATTGAATTAC
CTGATGTAGACGGAGCAATTGTATCAGGTACTGCTACTGGCGACTGGACACTATCCTGTGTTAGAGGCAG
TGTAAAAAGTATGACTTTTGTGTTCAATGATGGACGTATTGTGAGTACCTCTAATAAAGGGAATGGCGAA
GAGATTGGCTGGTTATCAGATAGTTCGGGTATCCCTTGTGTTCCAGGAGAGCGGAAAACCAATGCCCCAG
AATATTTGGGAACGAATTTCTTTTTGGCTGCTGCAAGTGCTGCTGCCCAAGGATTCTCACAGTCACAAAC
AACCACTGTTGTTGATGGAAGTAGTGTTGTTGGAGCTGTTACCGGCGATCAGGGTAAGTTCATCTTAGGA
CAAGCTATCGGAGGCGGCTTAAAAGAATCTGCTGACTGGTTTAGAAAACGTTTTGCTGAAAACTTTGATG
CTGTATATGTGCCACCGGGTCATCGTGTCTCTATTCATATCGAGAAAGAGATTGAAATCGATTACAACGC
CCAAGGTCGTAAAGTGAAATATGGCTCAAAATCAACGAATTCACAACTGGATTAG
 Primer design