SecReT4
Protein ID: 170717976
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1701
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1950430..1951314 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDB0UVS0
KEGG IDhsm:HSM_1701
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.9e-113, Aligned region: 5..279
Protein Sequence: 294 a.a.     [Download]
>gi|170717976|ref|YP_001785021.1| hypothetical protein HSM_1701 [Haemophilus somnus 2336]
MKRLPILLVSLLIGFSGSSLADVLMKWERKPLPVALQVEKERIIFVDKNVKVGYPAELDGKLRIQSTGGA
VYLKALETFPSTRIEFRDVTTGEIFLFDLTAASKVANPEEAIRVVFDGTVEKQSFSSNRDDESSDLPIAN
SRPQLPVPAALTRYAAQSLYAPLRTVEPLDGVRRVAHRLPKKITKLLPAYSIEATPLISWQLDEYVVTAI
RLQNKGNTQITLDPRELQGQFYAATFQHNWLGGYGENEDTTTLYLVTEGYANNALIPETRPVKLVSKKVK
RTTKVETKPAQSAK
 
Nucleotide Sequence: 885 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1951314-1950430 Haemophilus somnus 2336 chromosome, complete genome
ATGAAACGTCTACCAATTTTGCTCGTCTCTTTGCTTATAGGCTTCTCTGGGAGTAGCTTGGCTGATGTAT
TGATGAAATGGGAAAGAAAACCACTTCCTGTTGCGTTACAAGTGGAAAAAGAACGAATTATTTTTGTCGA
TAAAAATGTCAAGGTTGGTTATCCGGCAGAACTGGACGGTAAGCTACGAATTCAATCTACCGGTGGAGCC
GTCTATTTAAAAGCATTAGAAACATTTCCCTCCACTCGCATAGAATTCCGTGATGTTACAACCGGTGAAA
TTTTTCTATTTGATTTAACAGCAGCTTCGAAAGTCGCTAATCCTGAAGAGGCAATTCGAGTGGTTTTTGA
CGGTACGGTAGAAAAACAATCTTTTTCAAGCAATAGAGATGATGAAAGCTCTGATCTGCCTATTGCGAAT
AGCCGTCCTCAGCTTCCAGTACCTGCCGCATTGACCCGTTATGCAGCACAATCACTTTATGCTCCACTAC
GTACAGTTGAACCTTTAGATGGTGTGCGTCGTGTGGCACATCGTCTACCTAAAAAAATTACCAAGCTGCT
ACCGGCTTATTCAATAGAAGCAACACCTTTAATTAGCTGGCAGTTAGACGAATATGTAGTTACCGCTATT
CGTTTGCAAAATAAGGGTAACACTCAAATTACGCTTGACCCTCGAGAGCTTCAAGGACAATTTTATGCAG
CGACTTTCCAGCATAATTGGCTTGGGGGGTACGGAGAAAATGAAGATACCACAACCCTGTATTTAGTGAC
CGAAGGCTATGCTAATAACGCATTAATTCCGGAAACCCGTCCAGTCAAACTAGTCAGTAAAAAAGTGAAA
AGAACAACAAAAGTTGAAACTAAACCGGCTCAATCGGCGAAGTAG
 Primer design