SecReT4
Protein ID: 170717977
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1702
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1951314..1951958 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDB0UVS1
KEGG IDhsm:HSM_1702
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.9e-88, Aligned region: 6..203
Protein Sequence: 214 a.a.     [Download]
>gi|170717977|ref|YP_001785022.1| hypothetical protein HSM_1702 [Haemophilus somnus 2336]
MSQLKSQLHEKDKHIKTTRIFAFLFFIIILVLAGVIYTFPSRLTIYNPPDLRAGSQRAWWEIPKPTIYAF
SYQIFQQMNRWMTNGEEDYEKNITTLKPFLTPHCEAFLRQDYKDRLRNNELRSRTRMVYEITGRGYSEDK
VTIFSEDSWAVNLDLSVDEHFQGQPVKRVYIRFPISIVRMDVDSAQNPWGLGFNCYHSIPKLLEGVEPKT
EEKK
 
Nucleotide Sequence: 645 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1951958-1951314 Haemophilus somnus 2336 chromosome, complete genome
ATGAGCCAGTTAAAAAGCCAATTACACGAAAAAGATAAACATATCAAAACGACTCGAATTTTTGCCTTCC
TGTTTTTCATTATTATTTTGGTACTGGCAGGCGTAATCTATACTTTCCCAAGTCGCCTTACGATATACAA
CCCACCAGATCTGCGTGCTGGGAGCCAACGAGCTTGGTGGGAAATTCCTAAACCAACAATTTATGCATTC
TCCTATCAAATTTTCCAGCAAATGAATCGGTGGATGACAAATGGCGAAGAGGATTATGAGAAAAATATCA
CCACCCTCAAACCATTTTTAACACCACACTGTGAAGCATTTTTACGACAAGATTATAAAGATCGTCTGCG
TAACAATGAACTACGCAGCCGAACCCGTATGGTGTATGAAATTACCGGTAGAGGATATAGTGAAGATAAA
GTTACCATATTCAGTGAAGATAGTTGGGCTGTCAATCTTGATTTAAGTGTGGATGAACATTTCCAAGGAC
AGCCGGTAAAACGAGTTTATATTCGTTTTCCTATCAGTATTGTGAGAATGGATGTCGATTCTGCTCAAAA
CCCTTGGGGATTAGGGTTTAATTGCTATCACTCCATTCCAAAACTCTTAGAAGGTGTTGAGCCAAAAACA
GAGGAGAAAAAATAA
 Primer design