SecReT4
Protein ID: 170717978
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1703
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1951962..1952327 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDB0UVS2
KEGG IDhsm:HSM_1703
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.2e-42, Aligned region: 5..119
Protein Sequence: 121 a.a.     [Download]
>gi|170717978|ref|YP_001785023.1| hypothetical protein HSM_1703 [Haemophilus somnus 2336]
MSEQDTTIPFLPTRLNREATVYGGMTVSEFGISAGLGFMLGLIVGLFLWILTDFWLLIPAMAMLLCIATV
LIGKGIVAAVKRGKPEAYLNRLVEKKMDDLFNGHKFIKREGFWSIRRYRRK
 
Nucleotide Sequence: 366 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1952327-1951962 Haemophilus somnus 2336 chromosome, complete genome
ATGTCAGAACAAGATACAACCATTCCTTTTCTTCCCACCCGCCTTAATCGTGAAGCTACCGTTTACGGTG
GGATGACAGTTAGTGAGTTCGGCATATCTGCCGGATTAGGATTTATGTTAGGTCTGATTGTTGGTCTCTT
CTTGTGGATATTAACTGATTTTTGGCTTCTTATTCCGGCAATGGCAATGTTGCTCTGCATCGCAACTGTC
TTAATCGGAAAAGGTATTGTCGCTGCGGTTAAACGAGGAAAACCAGAGGCTTATTTAAATAGATTAGTTG
AAAAGAAAATGGATGACCTCTTTAACGGTCATAAGTTTATAAAACGAGAAGGGTTTTGGTCTATTCGCCG
ATATAGAAGGAAATAA
 Primer design