SecReT4
Protein ID: 170717979
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1704
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1952350..1952739 [-]
Producthypothetical protein
Component typeTfc10
UniProt IDB0UVS3
KEGG IDhsm:HSM_1704
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 1.5e-27, Aligned region: 39..127
Protein Sequence: 129 a.a.     [Download]
>gi|170717979|ref|YP_001785024.1| hypothetical protein HSM_1704 [Haemophilus somnus 2336]
MNRIKSLTKHLHSRYLAVMLFFWGSLQNAFAAGPDASKIPDFQIPGVDSNTKDPMEIIWIVLKGLVTLGA
VILAAVAILTVVKALIGIYNEATSENGKKGWGHFILALIIGFIVIFFCLWLVKLAVGLF
 
Nucleotide Sequence: 390 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1952739-1952350 Haemophilus somnus 2336 chromosome, complete genome
ATGAACCGCATTAAATCTCTTACGAAACATCTGCATAGTCGTTATTTGGCTGTAATGCTCTTCTTCTGGG
GTTCCCTCCAAAATGCATTTGCAGCCGGTCCTGATGCTTCCAAAATCCCAGACTTCCAAATTCCAGGCGT
GGATAGTAATACCAAAGATCCAATGGAAATTATTTGGATTGTTCTGAAAGGTCTTGTCACTCTCGGAGCT
GTTATTTTAGCAGCCGTAGCCATTTTGACAGTTGTTAAAGCATTGATTGGCATCTATAACGAAGCTACAT
CTGAAAATGGTAAAAAAGGTTGGGGACACTTTATTCTCGCCTTAATTATCGGCTTTATTGTGATTTTCTT
CTGCTTGTGGTTAGTCAAACTTGCAGTCGGACTCTTCTAA
 Primer design