SecReT4
Protein ID: 170717981
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1706
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1952987..1953313 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDB0UVS5
KEGG IDhsm:HSM_1706
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 7.2e-29, Aligned region: 23..102
Protein Sequence: 108 a.a.     [Download]
>gi|170717981|ref|YP_001785026.1| hypothetical protein HSM_1706 [Haemophilus somnus 2336]
MSISTSLRKGIVVLVTLSCLPALASTEQEQLAQAIKQLEAAKLSLQRAEKVAKASPKTREYFNYSAIHSD
IETVKKGIQQYINPSRALPRDPNVLRTLSDDYSKLRGQ
 
Nucleotide Sequence: 327 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1953313-1952987 Haemophilus somnus 2336 chromosome, complete genome
ATGTCTATTTCAACATCTTTAAGGAAAGGTATTGTTGTCCTTGTTACCTTATCTTGCTTGCCAGCACTTG
CTTCAACAGAACAAGAGCAATTAGCCCAGGCAATTAAGCAACTGGAAGCGGCAAAATTATCACTTCAACG
AGCAGAAAAAGTAGCTAAAGCCTCGCCTAAAACACGAGAATACTTTAACTATTCTGCTATTCACAGTGAT
ATTGAAACCGTCAAAAAAGGAATTCAACAATATATCAATCCAAGCCGAGCATTACCTCGTGATCCGAATG
TACTACGTACATTAAGTGATGATTATAGCAAATTACGGGGGCAGTGA
 Primer design