SecReT4
Protein ID: 170717983
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1708
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1953915..1954610 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDB0UVS7
KEGG IDhsm:HSM_1708
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1e-65, Aligned region: 41..228
Protein Sequence: 231 a.a.     [Download]
>gi|170717983|ref|YP_001785028.1| hypothetical protein HSM_1708 [Haemophilus somnus 2336]
MSEETKARRKSGLINLIFGKINMSLAAIAVSLIFSIILEWIGIAFWWPQEGHLHSQTMMLNEMQWLSDDF
SQSLFAKSSTAFATSIIENVYNWLFVYTGVKEWLTSPGNGSMEQWVHHYGRAYIESVIYVVITFIIRLII
IVFTSPLFLLTALSGLTEGLSLRDIRKFGAGRESAYLYHHARRYIMPMMVTAWVLYLSIPFSIHPNIILV
PAACLFGLSICITAASFKKFL
 
Nucleotide Sequence: 696 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1954610-1953915 Haemophilus somnus 2336 chromosome, complete genome
ATGAGTGAAGAAACTAAAGCTCGCCGAAAATCAGGTTTAATCAACCTGATTTTTGGAAAAATAAATATGT
CGCTTGCTGCAATTGCAGTATCTCTCATATTCAGCATTATTTTAGAGTGGATAGGCATTGCTTTCTGGTG
GCCGCAAGAAGGGCATTTGCATAGCCAAACGATGATGCTCAATGAGATGCAATGGCTATCGGATGACTTT
TCTCAAAGCCTGTTTGCCAAGTCTTCTACTGCTTTTGCAACATCAATTATTGAAAACGTGTATAACTGGT
TATTCGTTTATACGGGTGTTAAGGAGTGGTTAACTTCACCGGGTAATGGTAGTATGGAACAGTGGGTACA
TCACTACGGCAGAGCCTATATTGAATCTGTTATTTATGTGGTGATCACCTTTATTATTCGCCTCATTATT
ATTGTTTTTACCAGCCCACTCTTTTTATTGACTGCACTTTCCGGTTTAACCGAAGGACTGTCATTACGAG
ATATACGAAAATTTGGTGCCGGGCGGGAATCAGCCTACCTATACCATCACGCTAGACGTTATATTATGCC
AATGATGGTCACAGCTTGGGTGCTTTATTTATCTATCCCGTTTTCAATTCATCCGAACATCATTTTAGTC
CCAGCAGCCTGTTTGTTTGGTTTATCCATCTGTATAACTGCGGCGAGTTTCAAGAAATTCTTGTAA
 Primer design