SecReT4
Protein ID: 170717984
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1709
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1954607..1954960 [-]
Producthypothetical protein
Component typeTfc7
UniProt IDB0UVS8
KEGG IDhsm:HSM_1709
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 117 a.a.     [Download]
>gi|170717984|ref|YP_001785029.1| hypothetical protein HSM_1709 [Haemophilus somnus 2336]
MSSAKMREEKRTNLLDLPNKYRNFNGEFSASCGLDNAEELLIHSQSYFIEWFEQGYSFHQFAEKFADQGL
SLWSADEVSMRHSDKSKDIFAFYLAFDNNPSGYILVQCQLDREDSLQ
 
Nucleotide Sequence: 354 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1954960-1954607 Haemophilus somnus 2336 chromosome, complete genome
ATGAGTAGTGCCAAAATGAGAGAGGAAAAAAGAACCAATCTATTAGATTTACCAAATAAATACCGTAATT
TTAATGGGGAGTTTTCAGCTTCCTGTGGCTTAGATAATGCAGAAGAACTCCTGATTCATAGTCAATCCTA
TTTTATTGAATGGTTTGAACAAGGTTATTCCTTCCATCAGTTTGCCGAAAAATTCGCAGATCAAGGGCTT
TCGTTATGGTCTGCCGATGAAGTATCTATGCGTCACTCGGATAAATCCAAAGATATTTTCGCTTTTTATC
TTGCTTTTGATAATAATCCTTCCGGCTATATCCTTGTCCAGTGCCAGCTCGATAGAGAGGATAGTTTGCA
ATGA
 Primer design