SecReT4
Protein ID: 170717986
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1710
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1954953..1957154 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDB0UVS9
KEGG IDhsm:HSM_1710
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 6.6e-19, Aligned region: 503..632
AAA_10 [PF12846], Evalue: 1.7e-12, Aligned region: 184..580
TrwB_AAD_bind [PF10412], Evalue: 2.7e-11, Aligned region: 498..642
T4SS-DNA_transf [PF02534], Evalue: 1.2e-05, Aligned region: 499..647
Protein Sequence: 733 a.a.     [Download]
>gi|170717986|ref|YP_001785030.1| hypothetical protein HSM_1710 [Haemophilus somnus 2336]
MSAKHTLEAWLRPPVEFFPAAVHASCAFVSAAAPWSLALHPSIGYSIAAGFGALSFYRAKQGWQIVRYHR
NLKRLPNYSMTSKQIPVSNKYLFVGKGFEWKPIHTQRLHDCFSDNGSKYLEPSKLFKMAREYEKRHENWL
THLTSKDSRWNLVRPLPPVEGIPAIHGIEPDEVDVVQSVSSRVGHTVVFGTTRVGKTRLAEVFVTQDIHR
GKTADEREVVVFFDPKGDADMLKRMYAEAKRAGREDEFYVFHLGYPEISARYNPVGRFNRISEVAGRISG
QLSGAGNSAAFKEFAWRFVNIVARALVELGNRPNYVQISQFVQNIDSLFLDYAEKFIRKTDPKIWENLAT
IAAGLDEKALPFGMKDRPLIFVINKYIAESAVFDPILQGLASAVRYDRTYFDKIVASLLPLLEKLTTGKI
SELLSPDYADILDERPIFDWESIIRKRGIVYIGLDALSDATVAAAVGNSMFADLVSMAGHLYKFGTNDGL
PGAFKEKSKPVKINLHCDEFNELMGDEFIPLINKGGGAGIQVTAYTQTLSDIEARIGSKPKAGQTLGNFN
TLYMLRVKEPATAELLTKQLHEVTIKRSTVTSSTTDSSNPDDDKAFSSNTGQRISESTVPMLVPANITNL
PKGQAFALMDGSKLWKIRMPLPAVDKDDMMPQSLRELTDYMRKNYHVVENWWQPAFTEYTPSRDIAEAFE
AMSEPQYKTQIDHQVDNFGIDEPYDIDEEENDE
 
Nucleotide Sequence: 2202 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1957154-1954953 Haemophilus somnus 2336 chromosome, complete genome
ATGTCTGCTAAACATACCTTAGAGGCGTGGTTACGACCTCCTGTTGAATTTTTTCCGGCAGCGGTTCACG
CTTCTTGTGCCTTTGTCAGTGCTGCAGCTCCTTGGTCTTTGGCACTCCATCCAAGTATCGGTTACAGTAT
TGCAGCTGGTTTTGGAGCATTGAGCTTTTATCGGGCAAAACAAGGTTGGCAAATTGTGCGTTACCATCGC
AACCTGAAACGTTTGCCTAATTATTCAATGACAAGCAAGCAAATTCCGGTCAGTAATAAGTATCTGTTTG
TCGGTAAGGGATTTGAATGGAAACCTATTCACACTCAACGGTTACACGATTGTTTTTCGGATAACGGTTC
AAAATATCTGGAGCCTTCTAAGCTATTTAAAATGGCTCGTGAGTATGAAAAACGACACGAAAATTGGCTA
ACACATCTTACCTCAAAGGATAGCCGGTGGAATCTGGTTAGACCTCTGCCACCTGTTGAGGGTATTCCTG
CTATCCATGGAATTGAGCCGGATGAGGTTGATGTCGTTCAATCCGTTAGCTCTCGGGTTGGGCATACGGT
AGTATTCGGTACAACACGTGTCGGTAAAACTCGTTTAGCTGAGGTCTTTGTTACCCAGGATATCCACCGA
GGTAAAACTGCTGATGAGCGTGAAGTGGTAGTCTTCTTTGATCCGAAAGGCGATGCCGATATGCTCAAAC
GAATGTATGCGGAGGCAAAACGAGCGGGGCGAGAAGATGAGTTTTATGTTTTCCATCTAGGTTATCCCGA
AATTTCTGCCCGTTATAACCCAGTAGGACGCTTTAATCGTATTTCGGAAGTCGCTGGGCGTATTTCAGGA
CAGCTAAGTGGAGCGGGTAACTCGGCGGCATTTAAAGAGTTCGCTTGGCGATTTGTCAATATCGTCGCAC
GTGCATTAGTTGAATTGGGAAATCGCCCAAACTATGTTCAAATTTCCCAGTTTGTACAAAATATTGATTC
ATTATTCCTTGATTATGCGGAAAAATTCATTCGTAAAACCGATCCAAAAATTTGGGAAAATTTAGCAACC
ATCGCCGCTGGACTGGATGAAAAAGCACTTCCTTTCGGAATGAAAGACCGTCCGCTGATTTTTGTGATCA
ACAAGTACATTGCTGAAAGTGCAGTCTTTGACCCAATTCTACAAGGACTTGCCAGTGCTGTACGCTATGA
CCGTACCTATTTCGATAAAATTGTTGCCTCATTGTTGCCGTTATTGGAAAAATTAACGACAGGGAAAATT
TCTGAGCTGTTATCCCCGGATTATGCTGATATTTTGGATGAACGTCCGATTTTTGACTGGGAATCCATTA
TTCGTAAACGAGGAATCGTTTATATTGGTTTAGATGCTCTCTCTGATGCGACAGTTGCGGCCGCTGTAGG
AAACAGTATGTTTGCTGACTTAGTCTCAATGGCAGGTCATTTATATAAATTTGGGACAAATGACGGATTA
CCGGGAGCATTCAAAGAAAAATCCAAACCAGTGAAAATTAATCTTCATTGTGATGAATTTAATGAATTGA
TGGGTGATGAATTTATCCCTCTCATCAACAAAGGCGGTGGTGCTGGAATACAAGTAACTGCTTATACACA
AACACTCTCCGACATTGAAGCTCGTATCGGCAGTAAACCGAAAGCGGGACAAACCTTAGGTAACTTCAAT
ACACTCTATATGCTGAGGGTAAAAGAACCGGCTACGGCAGAATTACTCACAAAACAGTTACACGAAGTGA
CGATTAAACGTAGCACGGTCACGTCCAGTACAACTGACTCCAGTAATCCTGACGATGATAAGGCGTTTAG
CTCCAATACCGGACAGCGTATCAGCGAAAGTACCGTTCCTATGTTGGTTCCGGCCAACATTACCAATTTA
CCAAAAGGACAAGCATTCGCTTTAATGGACGGTAGTAAATTATGGAAAATTCGAATGCCGTTACCTGCTG
TCGATAAAGATGATATGATGCCTCAATCTTTACGAGAGCTGACAGATTATATGCGTAAAAACTATCACGT
TGTTGAAAATTGGTGGCAACCGGCATTTACAGAATATACGCCGTCCCGAGACATTGCAGAAGCATTTGAA
GCGATGTCGGAGCCTCAATATAAAACACAGATAGACCATCAAGTAGATAATTTCGGCATAGATGAACCTT
ACGATATTGATGAAGAGGAAAATGATGAGTAG
 Primer design