SecReT4
Protein ID: 170717987
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1711
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1957154..1957660 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDB0UVT0
KEGG IDhsm:HSM_1711
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.3e-50, Aligned region: 25..166
Protein Sequence: 168 a.a.     [Download]
>gi|170717987|ref|YP_001785031.1| hypothetical protein HSM_1711 [Haemophilus somnus 2336]
MQNKVKVLLFSLYVSHFSWADLTVIADFGGESAVRFYESLQPEHDENAPNYPNSISASVSEADILPIVSH
KLSPGTIKEKPFDLTGMQAIFLIGADNTSAQWLQQNREKLITLNATGLVVNVQTLSELNQLRDIVPELRI
LPTPGDDLAERIGIAHYPVLITESGVSQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1957660-1957154 Haemophilus somnus 2336 chromosome, complete genome
ATGCAAAACAAGGTAAAAGTATTATTGTTTAGTTTATATGTGTCCCATTTCTCTTGGGCTGATTTAACCG
TGATTGCTGATTTCGGTGGTGAAAGTGCGGTACGTTTTTATGAATCTTTGCAACCGGAACACGATGAAAA
TGCACCAAACTATCCGAATTCCATTTCAGCCTCAGTGAGTGAGGCTGATATTTTACCCATTGTTTCCCAT
AAACTATCTCCCGGGACTATTAAAGAAAAACCATTTGATTTAACCGGAATGCAAGCCATTTTCTTAATTG
GAGCAGATAATACCTCAGCTCAGTGGTTACAACAAAATCGAGAGAAGTTGATCACGTTGAATGCAACAGG
GCTTGTAGTGAATGTACAAACACTCTCCGAACTTAATCAATTACGAGACATTGTACCGGAACTGAGAATA
TTACCAACTCCCGGAGATGACCTTGCAGAGCGAATTGGTATTGCACATTACCCTGTCTTAATCACTGAAA
GCGGAGTTTCACAATAA
 Primer design