SecReT4
Protein ID: 170717988
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1712
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1957663..1958433 [-]
Producthypothetical protein
Component typeTfc4
UniProt IDB0UVT1
KEGG IDhsm:HSM_1712
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 256 a.a.     [Download]
>gi|170717988|ref|YP_001785032.1| hypothetical protein HSM_1712 [Haemophilus somnus 2336]
MDITRVLVIVAVFLSNISISQAKPFNGFGSEIDSYIRMAAQRYQVSEAMLRGFVKMEDGWYGNISPTGAT
GVGQFTMGTWNWLSETERGKQLGMKLITAKNRGSYADPRRDKYTNTLATALLARWHIEQFQLRNIPITDE
NLYMAHNIGLDGLHRAMMGKATKEDILNMRRNGMKSWMTVRDFLNYQKGRFLAHKQEANFMTVSKQGHIH
TGVAAFVYPTSQMGKSVKWVEPDNKMIWVEPKNAMVWVEPQNTLQR
 
Nucleotide Sequence: 771 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1958433-1957663 Haemophilus somnus 2336 chromosome, complete genome
ATGGACATCACTCGTGTATTAGTCATTGTTGCAGTCTTTCTTTCCAACATTAGCATTTCTCAGGCAAAGC
CCTTCAATGGATTTGGTTCTGAAATTGACAGCTATATTCGTATGGCTGCTCAACGTTATCAGGTGAGTGA
AGCAATGCTACGAGGTTTTGTCAAAATGGAAGATGGCTGGTATGGCAACATTTCACCAACAGGAGCAACC
GGTGTTGGGCAGTTTACTATGGGAACCTGGAACTGGCTATCTGAAACAGAGAGGGGAAAGCAACTTGGTA
TGAAGTTGATTACAGCCAAAAATCGGGGTTCTTACGCCGATCCCCGTCGAGATAAATATACGAATACCTT
AGCAACGGCATTATTGGCACGTTGGCATATTGAGCAATTTCAACTCCGTAATATCCCTATTACTGATGAG
AATTTATATATGGCTCATAATATCGGCTTAGATGGGCTGCATCGAGCAATGATGGGGAAAGCTACTAAAG
AAGACATTTTAAATATGCGTCGTAATGGAATGAAAAGTTGGATGACGGTAAGAGACTTTCTCAATTACCA
AAAAGGACGTTTTTTAGCACATAAGCAAGAAGCCAATTTTATGACTGTCTCCAAGCAAGGGCATATTCAT
ACCGGAGTTGCAGCTTTCGTTTATCCCACAAGCCAAATGGGAAAATCGGTCAAATGGGTTGAGCCGGATA
ATAAAATGATTTGGGTTGAACCTAAAAATGCAATGGTTTGGGTAGAACCCCAAAATACTCTTCAGAGGTA
A
 Primer design