SecReT4
Protein ID: 170717989
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1713
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1958412..1959185 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDB0UVT2
KEGG IDhsm:HSM_1713
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 257 a.a.     [Download]
>gi|170717989|ref|YP_001785033.1| hypothetical protein HSM_1713 [Haemophilus somnus 2336]
MREISMKFNLCRKAIPLAVLPLLLSFALPTLAQNMQTETVSSSQSTLQKQSQHQQSQLSDSLKQAKEWGL
TVEEWSRYTELMKGERGMWSPNLDPLTALGIEARTAEEREKYARMLAKKYYERVSKELDFDKVYRQEFEK
LYPNELPFEVEPHISQSVGRVVYFTRFDNCDSCKSDLGKILSYANNQTPLDIYIVGQNISDNDIRKWAAD
NNIDPIKVSKRLITLNHDKGYWLRYSLGKMPAAYQIKQDGEWTSLVY
 
Nucleotide Sequence: 774 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1959185-1958412 Haemophilus somnus 2336 chromosome, complete genome
ATGAGGGAAATATCAATGAAGTTTAATTTATGCCGTAAAGCTATACCGTTGGCAGTACTACCTCTTTTAT
TGTCCTTTGCATTACCTACTCTGGCTCAAAATATGCAAACAGAGACCGTAAGTAGCTCACAATCGACTTT
GCAGAAACAAAGCCAACATCAACAATCACAATTAAGTGATAGCCTAAAACAGGCTAAAGAATGGGGATTG
ACCGTTGAAGAATGGAGTCGTTATACCGAATTAATGAAAGGTGAGCGAGGTATGTGGTCGCCAAATCTAG
ATCCGTTAACTGCTTTAGGTATCGAAGCACGAACTGCTGAGGAAAGGGAAAAATATGCTCGTATGTTGGC
GAAAAAATATTATGAACGAGTGTCAAAAGAACTTGATTTTGACAAAGTTTATCGTCAGGAGTTTGAGAAA
CTTTATCCGAATGAGCTACCTTTTGAGGTTGAACCACATATTTCTCAATCGGTAGGTCGTGTGGTTTATT
TTACCCGTTTTGATAACTGCGATTCTTGTAAAAGTGATCTTGGGAAAATCCTCTCTTACGCAAATAATCA
AACACCTCTCGATATTTATATTGTTGGGCAAAACATCTCCGATAATGATATTCGTAAATGGGCTGCCGAC
AATAATATTGACCCAATAAAAGTCAGTAAAAGATTGATTACCCTTAACCACGATAAAGGCTATTGGCTGA
GATATTCGTTAGGAAAAATGCCCGCTGCTTACCAAATCAAACAGGATGGTGAATGGACATCACTCGTGTA
TTAG
 Primer design