SecReT4
Protein ID: 170717990
T4SS name [ID]Tfc [568]
Gene symbol-
Locus tagHSM_1714
StrainHaemophilus somnus 2336
Repliconchromosome [GenBank: NC_010519] [Browse all T4SS(s) in this replicon]
Location [Strand]1959185..1959814 [-]
Productlipoprotein
Component typeTfc2
UniProt IDB0UVT3
KEGG IDhsm:HSM_1714
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 209 a.a.     [Download]
>gi|170717990|ref|YP_001785034.1| lipoprotein [Haemophilus somnus 2336]
MKTKISLMTVFMLGLSGCVHQQDTAQNSDEITPMPDSLLTPQMQQLPPQDRIVSKDIYQEQTTSNTEVVR
DGRYTLISIAPEEGQKYLLEQVVSVKVSNPKNRFTANVQQGLRSTLTNTGLDLCYPPIGEQGNAVQTLFT
RPLPKVHYQFGPMKLYEALQMIAGPAYELTLNDISRTICFKARESSFQNPHKPAVAVTTTTIKTEVIEE
 
Nucleotide Sequence: 630 bp     [Download]
>gi|170717206|ref|NC_010519.1|:c1959814-1959185 Haemophilus somnus 2336 chromosome, complete genome
ATGAAAACAAAAATATCCTTAATGACTGTTTTTATGCTTGGCTTAAGTGGTTGTGTTCATCAACAGGATA
CAGCTCAAAATAGTGATGAAATCACACCTATGCCTGATTCATTGCTAACACCTCAAATGCAACAATTACC
TCCACAAGACCGTATCGTGTCCAAAGATATTTACCAAGAACAGACTACCTCGAATACCGAAGTGGTACGT
GACGGACGCTACACCTTAATCAGTATTGCTCCGGAGGAAGGTCAAAAATATCTGCTTGAACAAGTCGTAT
CAGTCAAAGTCTCCAATCCTAAAAATCGTTTTACTGCGAATGTCCAGCAAGGTTTGCGTTCTACATTAAC
TAATACGGGTTTAGATTTGTGTTATCCACCTATCGGAGAACAAGGTAATGCGGTTCAAACACTTTTTACC
CGACCTCTTCCAAAAGTTCATTACCAATTCGGTCCGATGAAATTATATGAAGCTCTACAAATGATTGCAG
GTCCCGCTTATGAACTAACTCTTAATGATATATCCCGTACGATTTGCTTTAAAGCTCGGGAAAGTTCATT
CCAAAACCCTCATAAACCTGCTGTTGCCGTTACAACGACAACAATTAAAACCGAGGTCATTGAGGAATAA
 Primer design