SecReT4
Protein ID: 170722469
T4SS name [ID]Tfc [737]
Gene symbol-
Locus tagPputW619_3303
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T4SS(s) in this replicon]
Location [Strand]3642386..3642940 [+]
Productlytic transglycosylase
Component typeTfc4
UniProt IDB1JAZ2
KEGG IDppw:PputW619_3303
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 184 a.a.     [Download]
>gi|170722469|ref|YP_001750157.1| lytic transglycosylase [Pseudomonas putida W619]
MAAYRLILALALTGTTAVHAGSLPPPAYQLAAERAGIPASVLFAIALQESGTPLRGHLMPWPWTLNVAGT
PLRFARRDEACAALKQALIRHDPKRIDVGLGQTNLGYHLDRYHSACEALDPRANLAVTAELLRAHYADSG
DWVVAAGRYHRPAGGKPAAQYRRQFSQHWQRVQAVVGSPRGPRP
 
Nucleotide Sequence: 555 bp     [Download]
>gi|170719187|ref|NC_010501.1|:3642386-3642940 Pseudomonas putida W619 chromosome, complete genome
ATGGCAGCGTATCGACTGATCCTGGCGCTGGCCTTGACCGGCACTACGGCCGTTCATGCGGGCTCGCTGC
CGCCGCCGGCGTATCAACTGGCCGCCGAGCGCGCTGGCATCCCAGCGTCAGTGCTGTTCGCCATCGCCCT
GCAGGAGAGCGGTACGCCGCTGCGGGGTCACCTCATGCCCTGGCCTTGGACCTTGAATGTCGCCGGCACA
CCGCTGCGCTTCGCCCGCCGTGATGAGGCGTGTGCTGCACTCAAGCAGGCGCTGATCCGCCACGACCCCA
AGCGCATCGATGTCGGGCTGGGGCAGACCAACCTCGGCTACCACCTGGACCGCTATCACAGTGCCTGCGA
GGCCCTCGATCCACGCGCCAACCTGGCTGTGACTGCCGAGCTGCTGCGCGCCCACTATGCCGACAGCGGT
GACTGGGTCGTGGCGGCAGGCCGCTATCACCGTCCTGCCGGCGGTAAACCCGCAGCGCAGTACCGCCGAC
AGTTCAGCCAGCACTGGCAGCGGGTTCAGGCAGTTGTGGGATCTCCGAGAGGGCCACGGCCATGA
 Primer design