SecReT4
Protein ID: 170722471
T4SS name [ID]Tfc [737]
Gene symbol-
Locus tagPputW619_3305
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T4SS(s) in this replicon]
Location [Strand]3643366..3645489 [+]
Producthypothetical protein
Component typeTfc6
UniProt IDB1JAZ4
KEGG IDppw:PputW619_3305
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 3.4e-17, Aligned region: 503..633
TrwB_AAD_bind [PF10412], Evalue: 5.4e-09, Aligned region: 504..640
AAA_10 [PF12846], Evalue: 8.8e-09, Aligned region: 189..580
Protein Sequence: 707 a.a.     [Download]
>gi|170722471|ref|YP_001750159.1| hypothetical protein PputW619_3305 [Pseudomonas putida W619]
MTEHAMESLLRPAVELYTVGICAGAGALCLHSPWAVALSPEVGAGMALAYTAFGLKRLNEARIVLRYRRN
IRRLPRYSLTSRQIPISGKRLFMGRGFRWTRLHTQRLLEAQDPALARYVNQSAAHQWARRMEHLLEKAPP
GLSLLPRLTAWDSPLNPVRPLPPVGGSPLLHGVEPKEQEAGLPLGERVGHTLVLGTTRVGKTRLAEVYIT
QDIHRPSQEVVIVFDPKGDADLLKRMYVEARRAGREQEFYVFHLGWPEISARYNAIGRFGRISEVATRIA
GQLSGEGNSAAFREFAWRFVNIIARALIELGRRPDYLQIQRHVVNIDALFIEYAQHFFARHDPQAWEAIV
QIEGRLNEKNIPRHMIGREKRVVAIEQYLTAKRIFDPVMDGLRSAVRYDRTYFDKIVASLLPLLEKLTSG
KTAQLLAPNYTDLDDPRPIFDWLQVIRKRGIVYVGLDALSDAEVAAAVGNSMFADLVSVAGHIYKHGIDH
GLPGSSSAADKVPINLHADEFNELMGDEFIPLINKGGGAGIQVTAYTQTLSDIEARIGNRAKAGQVIGNF
NTLQMLRVRETATAELLTNQLPKVNVQTRTLVSSATDTADPDARTDFTSSSQDRVTTTSVPLIEPAHIIA
LPKGQMFSFQEGGQLWKVRMPLPKPASDDAMPADLQALTARMRESYNANAGSWWSTTGGAPTVDFDPEMP
PPGRRHS
 
Nucleotide Sequence: 2124 bp     [Download]
>gi|170719187|ref|NC_010501.1|:3643366-3645489 Pseudomonas putida W619 chromosome, complete genome
ATGACCGAACATGCGATGGAGTCCCTGCTGCGCCCTGCGGTGGAACTGTACACCGTGGGCATCTGCGCCG
GTGCCGGCGCGCTGTGCCTGCATTCGCCCTGGGCGGTGGCGCTGTCGCCCGAGGTAGGCGCAGGCATGGC
CCTGGCCTATACCGCATTTGGCCTGAAGCGGCTCAATGAGGCGCGGATCGTCCTGCGCTACCGGCGCAAT
ATCCGCCGCCTGCCGCGCTACTCGCTGACCAGCCGACAAATTCCGATCAGCGGCAAGCGCCTGTTCATGG
GCCGCGGCTTTCGCTGGACCCGCCTGCACACCCAGCGTCTGCTCGAAGCACAAGACCCAGCGCTGGCCCG
CTACGTCAATCAATCGGCCGCCCACCAATGGGCGCGGCGGATGGAACACCTGCTGGAGAAGGCCCCGCCC
GGGCTGTCACTGCTGCCTCGCCTGACCGCCTGGGACAGTCCACTCAATCCCGTGCGTCCGCTGCCGCCTG
TGGGTGGCTCGCCATTGCTGCACGGCGTCGAGCCTAAGGAACAGGAAGCCGGCTTGCCACTGGGCGAGCG
CGTCGGCCACACCCTGGTGCTGGGGACCACGCGGGTCGGCAAGACGCGCCTGGCCGAGGTGTACATCACC
CAGGACATTCATCGACCAAGCCAGGAGGTGGTGATCGTCTTCGATCCCAAGGGCGATGCCGACCTGCTCA
AGCGCATGTACGTGGAAGCGCGGCGCGCCGGCCGTGAGCAAGAGTTTTACGTTTTCCACCTAGGCTGGCC
GGAGATCTCCGCCCGCTACAACGCCATCGGCCGCTTCGGCCGCATTTCCGAAGTCGCCACCCGCATCGCT
GGCCAACTGAGCGGCGAAGGCAACTCGGCCGCATTTCGCGAGTTCGCCTGGCGCTTCGTCAATATCATCG
CCCGGGCGCTGATCGAGCTCGGCCGGCGCCCTGACTACCTGCAGATTCAGCGGCACGTGGTGAACATCGA
TGCGCTGTTCATCGAGTACGCTCAGCACTTCTTCGCCCGCCATGATCCGCAGGCCTGGGAAGCAATCGTG
CAGATCGAAGGTCGCCTGAACGAGAAGAACATACCGCGGCACATGATCGGTCGGGAAAAGCGCGTGGTCG
CCATCGAGCAGTACCTGACTGCCAAGCGCATTTTCGATCCGGTGATGGACGGCCTGCGTTCGGCAGTGCG
CTACGACCGCACCTATTTCGACAAGATCGTGGCCTCGCTGCTGCCACTGCTGGAAAAACTCACCAGCGGC
AAGACCGCGCAACTGCTCGCCCCCAACTACACCGACCTCGACGATCCGCGGCCGATCTTCGACTGGCTCC
AGGTCATCCGCAAACGCGGCATCGTCTACGTTGGCCTGGACGCGCTGTCCGACGCCGAGGTGGCGGCTGC
CGTCGGCAACTCGATGTTTGCCGACCTGGTTTCGGTCGCTGGCCATATCTACAAACACGGCATTGATCAC
GGCCTGCCTGGATCCTCCAGCGCCGCGGACAAGGTGCCGATCAACCTGCACGCCGACGAGTTCAACGAGC
TGATGGGTGACGAATTCATTCCGCTGATCAACAAAGGTGGTGGCGCCGGAATTCAAGTCACTGCCTACAC
CCAGACCTTGAGCGACATCGAGGCGCGTATCGGCAACCGGGCCAAGGCCGGCCAGGTCATCGGCAATTTC
AATACTCTGCAGATGCTGCGGGTGCGGGAAACCGCCACCGCAGAACTGCTGACCAACCAACTGCCCAAGG
TCAACGTGCAGACCCGCACGCTGGTCTCCAGCGCGACAGATACTGCCGATCCTGATGCCCGCACCGACTT
CACCTCTTCCTCGCAGGATCGAGTCACCACCACTTCGGTACCACTGATTGAACCCGCGCACATCATCGCC
TTGCCCAAGGGGCAGATGTTCTCTTTCCAGGAGGGAGGACAATTGTGGAAGGTGCGTATGCCCCTACCGA
AGCCGGCCAGCGACGATGCGATGCCGGCGGATCTGCAGGCCCTAACCGCACGCATGCGCGAATCCTACAA
CGCCAATGCGGGGAGTTGGTGGAGCACCACCGGCGGTGCTCCGACGGTCGATTTCGATCCCGAGATGCCT
CCACCCGGACGCCGGCACTCCTAA
 Primer design