SecReT4
Protein ID: 170722472
T4SS name [ID]Tfc [737]
Gene symbol-
Locus tagPputW619_3306
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T4SS(s) in this replicon]
Location [Strand]3645588..3646256 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDB1JAZ5
KEGG IDppw:PputW619_3306
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.4e-60, Aligned region: 25..219
Protein Sequence: 222 a.a.     [Download]
>gi|170722472|ref|YP_001750160.1| hypothetical protein PputW619_3306 [Pseudomonas putida W619]
MLELCLRLLGLLFASLFFSIVLELVGMLWFWPEQGWHHSHAMWLSELGWLSNHFKSSLLVQEPAQATAKV
LEQLNHWFVVRSGWAQSDTQLKLLSRETSMQGQFAQVYVVMQDYLLAALFTVFTFVVRLAVLTLATPLFL
LAVITGAVDGLMRRDLRKFGADRESSFVYHRAKRAIFPLMVSPWVIYLSLPWTLNPICVLLPCAVLLGFT
VAITTTTFKKYL
 
Nucleotide Sequence: 669 bp     [Download]
>gi|170719187|ref|NC_010501.1|:3645588-3646256 Pseudomonas putida W619 chromosome, complete genome
ATGCTCGAGCTGTGTCTGCGGCTGCTCGGCCTGCTGTTCGCTTCGCTGTTTTTTTCCATCGTGCTGGAGC
TGGTGGGCATGCTCTGGTTCTGGCCCGAGCAGGGCTGGCATCACAGCCATGCCATGTGGCTAAGCGAATT
GGGCTGGCTCAGCAATCACTTCAAGAGTTCGTTGCTCGTGCAAGAACCGGCGCAAGCGACCGCCAAGGTC
CTCGAACAGCTGAACCACTGGTTCGTGGTGCGCTCTGGTTGGGCGCAATCCGATACCCAGCTGAAACTGC
TCAGTCGAGAAACGTCAATGCAGGGGCAGTTCGCGCAGGTCTACGTTGTGATGCAGGACTACCTGCTGGC
GGCCCTGTTTACAGTATTTACTTTCGTAGTGCGTCTAGCCGTTTTGACCCTGGCCACCCCGCTGTTCTTG
CTTGCGGTGATCACCGGCGCTGTCGATGGGCTTATGCGTCGCGACCTGCGCAAGTTCGGGGCAGACCGCG
AAAGCAGCTTCGTCTACCATCGCGCAAAGAGGGCAATTTTCCCGCTGATGGTGAGCCCATGGGTGATCTA
TCTCTCTCTGCCTTGGACACTCAATCCTATATGTGTGTTGCTGCCTTGCGCAGTCCTACTTGGTTTCACG
GTGGCGATCACCACTACGACGTTCAAAAAATATCTCTGA
 Primer design