SecReT4
Protein ID: 170722491
T4SS name [ID]Tfc [737]
Gene symbol-
Locus tagPputW619_3325
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T4SS(s) in this replicon]
Location [Strand]3664833..3665234 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDB1JB14
KEGG IDppw:PputW619_3325
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.3e-46, Aligned region: 10..128
Protein Sequence: 133 a.a.     [Download]
>gi|170722491|ref|YP_001750179.1| hypothetical protein PputW619_3325 [Pseudomonas putida W619]
MSDAPATLPDGTLSFLPERLNRDPAVLRGLTNDEMWVALIMGAGLGVILGAPLAVATASIATLPTCMFIC
MALVLLGGGKLLRRAKRARPETWLYRRLQWHLAVHWGVGTHQLILHSGPWTVRRTRRHARATP
 
Nucleotide Sequence: 402 bp     [Download]
>gi|170719187|ref|NC_010501.1|:3664833-3665234 Pseudomonas putida W619 chromosome, complete genome
ATGTCCGACGCCCCTGCCACCCTGCCTGACGGCACGTTGAGCTTCCTCCCCGAACGCCTCAATCGTGACC
CGGCCGTCTTGCGCGGACTCACCAACGACGAGATGTGGGTCGCATTGATCATGGGCGCAGGGCTAGGTGT
GATTCTCGGCGCGCCGCTGGCGGTGGCCACCGCCTCCATCGCTACCCTCCCCACCTGTATGTTCATCTGC
ATGGCGCTGGTGTTGCTGGGCGGCGGCAAGCTACTGCGCCGAGCCAAACGTGCTCGTCCCGAAACCTGGC
TATACCGACGTCTGCAGTGGCACCTGGCTGTGCACTGGGGTGTCGGCACTCATCAGTTGATCCTGCACTC
GGGGCCTTGGACAGTGCGCCGCACGCGTCGACATGCGAGGGCGACGCCATGA
 Primer design