SecReT4
Protein ID: 170722498
T4SS name [ID]Tfc [737]
Gene symbol-
Locus tagPputW619_3332
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T4SS(s) in this replicon]
Location [Strand]3672494..3673849 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDB1JB44
KEGG IDppw:PputW619_3332
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 451 a.a.     [Download]
>gi|170722498|ref|YP_001750186.1| hypothetical protein PputW619_3332 [Pseudomonas putida W619]
MNNLALGLVCFLVCAAGHAAENGYHLGAQAPVLDDRVMYTIGGGSAAGAPSSLYRPNGLGVGMSWRANMM
CGNMSLSNTLQNQLNGATQGFQQIMGNVIQNATQAVMSLPAMIIQRANPGLYELLSNGVLQGRIDFDRSK
LTCQAMAAKMADKVDQAGWGALAQNQEMQHNLEQSDGDAVTAVKDTESNNGNNGVSWIGGQKAGGHGQAP
IRVTSDVVKTGYNLLHNRSVEDTSTVGSSCQNGAICQAWSSPDEAAEWATRVLGETEVKTCNDCETLRVS
AGAGLTPLIQETYTQHLEGLQRMLSGAEEPTPENLGKVSSPLLQVSRGVIEGLRDDPDQNLLARRLASET
ALSSVIYKAMLLQRTLLAGSHEPNVASAQPATTALNSNVETLEREIRLLQTELQVRQALATNTASLVLDR
HAGGADASRNIDQRDPRPDRLQRADQGRSTP
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|170719187|ref|NC_010501.1|:3672494-3673849 Pseudomonas putida W619 chromosome, complete genome
ATGAACAACCTCGCGCTCGGGTTGGTGTGCTTCCTAGTTTGTGCTGCAGGCCATGCTGCAGAGAACGGCT
ACCACCTTGGTGCCCAGGCTCCGGTCCTAGATGACCGCGTGATGTACACCATCGGTGGCGGCTCAGCTGC
CGGTGCGCCCTCCTCGCTCTACCGCCCCAATGGCCTCGGCGTCGGCATGTCCTGGCGGGCCAACATGATG
TGCGGAAACATGAGCCTCTCGAACACTCTGCAGAACCAGCTCAATGGCGCCACCCAGGGTTTCCAGCAAA
TCATGGGGAACGTCATCCAGAACGCCACACAAGCGGTCATGTCGCTGCCGGCAATGATCATCCAGCGCGC
CAACCCCGGGCTGTACGAGCTGCTGAGCAACGGCGTGCTGCAGGGGCGCATCGACTTTGACCGTTCGAAG
CTCACCTGCCAGGCGATGGCGGCGAAGATGGCCGACAAGGTGGATCAGGCCGGTTGGGGGGCACTGGCGC
AGAACCAGGAAATGCAGCACAACCTGGAGCAGTCCGACGGTGATGCCGTTACGGCGGTAAAGGACACCGA
GTCCAACAACGGCAACAACGGCGTCAGCTGGATTGGCGGGCAGAAAGCCGGCGGCCATGGCCAGGCGCCG
ATCCGGGTGACCTCGGACGTGGTCAAGACGGGTTACAACCTGCTGCACAACCGCTCGGTCGAAGACACCT
CGACCGTCGGCTCAAGTTGTCAGAATGGCGCGATTTGCCAGGCTTGGTCGAGCCCCGACGAGGCTGCTGA
GTGGGCCACTCGAGTGCTCGGCGAAACCGAGGTAAAGACCTGTAACGATTGCGAGACGCTGCGCGTGAGC
GCGGGCGCCGGTCTTACGCCACTGATTCAGGAAACCTACACCCAGCACCTTGAGGGCTTGCAGCGCATGT
TGTCAGGCGCTGAGGAACCCACCCCAGAGAACTTGGGCAAAGTCTCCAGCCCGTTGCTGCAGGTCTCACG
CGGCGTCATCGAAGGCCTGCGCGATGACCCCGACCAGAACCTACTGGCCCGACGTTTGGCCAGCGAGACC
GCGTTGTCGAGCGTGATCTACAAGGCAATGCTGCTGCAGCGCACGTTGCTGGCCGGCAGCCATGAACCCA
ATGTGGCGTCGGCGCAGCCCGCCACTACCGCCCTCAACAGCAACGTCGAAACGCTGGAGCGCGAGATCCG
CCTGCTGCAAACCGAGTTGCAGGTGCGCCAAGCGCTGGCCACCAATACCGCCAGTCTGGTCCTCGATCGT
CACGCCGGCGGCGCCGATGCCTCACGCAATATCGACCAGCGCGATCCACGCCCAGACCGCCTGCAGCGAG
CGGATCAGGGAAGGAGCACGCCATGA
 Primer design