SecReT4
Protein ID: 170736573
T4SS name [ID]VirB [205]
Gene symbol-
Locus tagBcenmc03_4192
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome 2 [GenBank: NC_010515] [Browse all T4SS(s) in this replicon]
Location [Strand]1127230..1128942 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDB1K7J0
KEGG IDbcm:Bcenmc03_4192
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.2e-106, Aligned region: 17..449
TraG-D_C [PF12696], Evalue: 2e-28, Aligned region: 295..416
TrwB_AAD_bind [PF10412], Evalue: 9.8e-24, Aligned region: 203..430
Protein Sequence: 570 a.a.     [Download]
>gi|170736573|ref|YP_001777833.1| TRAG family protein [Burkholderia cenocepacia MC0-3]
MRQIAPAKSQPTLVVGRWRGRYLRFAGQQFVLLAAPARSGKGVGIVIPNLLSYSDSVVVLDIKQENFRLT
AGFRRAHGQAVYLFNPFAEDGCTHRYNPLSVIADDMFRVGDILAIGYVLYPAGGHDEFWKDQARNLLLGL
VLLLCDLREARRAGASGVPDYPITMGEVLRQSSGNGQPVKTYLNRMLIQHRQYLSRACIDALNRFLANDD
KVLASILATFNASLTIWANPIVDAATSANDFDLRDVRRRKMSVYLGVTPDHLSEAAILMNLMFSQLVNLN
TKELAEDNPALKYQCLLLLDEMTAIGKIQIIARAVAYMAGYNLRLLSIVQSDSQLESVYGRADARTIVTN
HAMQILFAPREQKDANAYSEMLGTRTERSRSTSRSNGMFGARGGASESFSDQRRALMLPQEIKELARDKE
IILLENTKPILADRICYWRDRAFTSRVMDAPAVPALDLVGFGAQIEQRLRELSDDDVDEQTGELTHVRAD
YLELVHAWDPRELPQALDNVSCEEAAAYVDRHFTLLGVPAEDVARAGRRLARGEDGMTDTETGARKRDPS
PVARASGGVQ
 
Nucleotide Sequence: 1713 bp     [Download]
>gi|170735571|ref|NC_010515.1|:c1128942-1127230 Burkholderia cenocepacia MC0-3 chromosome 2, complete sequence
ATGAGACAGATTGCACCCGCGAAGTCTCAACCGACGCTTGTGGTGGGCCGTTGGCGTGGCCGCTACCTGC
GCTTTGCCGGTCAGCAATTCGTGCTACTTGCCGCGCCTGCTCGTTCAGGAAAAGGCGTGGGGATTGTGAT
CCCGAATCTGCTGAGCTATTCCGACTCCGTGGTCGTGCTCGATATCAAACAGGAAAATTTTCGCCTCACG
GCAGGCTTTCGGCGCGCGCACGGACAAGCCGTGTACCTGTTCAATCCGTTTGCAGAAGATGGTTGCACGC
ACCGCTACAACCCGTTGTCGGTCATTGCAGACGACATGTTTCGCGTCGGCGACATTCTGGCGATCGGTTA
TGTGTTGTATCCGGCCGGCGGGCATGACGAATTCTGGAAAGACCAGGCACGCAACCTTCTGTTGGGACTG
GTCCTGCTGCTGTGCGATTTGCGTGAGGCGCGTCGTGCTGGCGCGAGCGGGGTGCCCGACTACCCGATCA
CAATGGGCGAGGTATTGCGGCAATCGTCGGGAAATGGTCAGCCGGTCAAAACCTACTTGAACCGGATGCT
TATACAGCATCGACAGTACTTGAGCCGCGCCTGTATTGATGCACTGAATCGATTCCTCGCGAATGACGAC
AAGGTCCTGGCGAGCATTCTGGCCACTTTTAATGCGTCACTGACGATCTGGGCCAACCCGATTGTTGACG
CGGCGACGAGCGCGAACGACTTTGATCTGCGAGACGTCAGACGCCGCAAGATGTCCGTATATCTTGGCGT
GACGCCCGATCACTTAAGTGAGGCGGCGATACTGATGAATCTGATGTTCTCGCAGCTCGTGAATCTGAAC
ACGAAGGAGTTGGCAGAGGACAATCCGGCATTGAAGTATCAATGCCTGCTGCTGCTCGACGAGATGACGG
CAATCGGAAAAATCCAGATTATCGCGCGTGCGGTGGCTTATATGGCGGGCTACAACCTGCGCCTACTCTC
GATCGTGCAATCCGACTCGCAGCTCGAGTCTGTGTATGGCCGAGCTGACGCGAGGACCATTGTCACGAAT
CATGCGATGCAGATTCTTTTCGCCCCGCGCGAACAGAAGGACGCCAATGCCTACTCCGAGATGCTCGGCA
CGCGCACGGAGCGATCGCGCAGCACCAGCCGATCGAATGGCATGTTCGGTGCGCGCGGCGGTGCGAGCGA
GAGCTTTTCCGATCAACGTCGTGCGCTGATGTTGCCGCAGGAGATCAAGGAGCTCGCGCGCGACAAGGAA
ATCATTCTTCTCGAAAATACCAAGCCGATTTTGGCAGACCGGATCTGCTATTGGCGCGATCGTGCATTTA
CTTCACGGGTAATGGACGCGCCAGCGGTGCCTGCACTCGATCTCGTGGGATTTGGTGCACAAATCGAGCA
GCGGCTGCGCGAACTGAGCGATGACGACGTCGATGAACAGACGGGCGAGCTGACGCATGTGCGAGCGGAC
TATCTGGAACTTGTACACGCCTGGGATCCGCGCGAGCTGCCGCAGGCGCTGGACAATGTCAGTTGCGAGG
AGGCAGCCGCGTATGTGGATCGGCATTTCACGCTGCTGGGCGTGCCGGCCGAGGACGTAGCGCGCGCCGG
ACGTCGGTTGGCGCGCGGCGAAGATGGCATGACTGATACTGAGACGGGCGCGCGCAAGCGTGACCCGAGC
CCCGTCGCCCGGGCAAGTGGTGGTGTTCAATGA
 Primer design