SecReT4
Protein ID: 170736575
T4SS name [ID]VirB [205]
Gene symbol-
Locus tagBcenmc03_4194
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome 2 [GenBank: NC_010515] [Browse all T4SS(s) in this replicon]
Location [Strand]1129306..1130457 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB1K7J2
KEGG IDbcm:Bcenmc03_4194
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1e-60, Aligned region: 36..340
Protein Sequence: 383 a.a.     [Download]
>gi|170736575|ref|YP_001777835.1| P-type DNA transfer ATPase VirB11 [Burkholderia cenocepacia MC0-3]
MKAFEATLQPQTDRVADTMSVLPDDASVTELMRSFAPLLADEAVTELVINRPQRILTETHRGWQAHDLPE
LDFERLMAFAVAIATLTNQSVSTEHPLLSALLPDNARLQLAVPPVVPSRTVSVTIRRPSADEKTLECHRA
DGMFEDTVWRHVSGLGKTGQALRAVDRMLVEQLEARDFAAFFEGAVRAHRNIVIVGSTGSGKTSFMRSLC
RYLGATERIVTIEDVRELFIRHVENCVHLLYSKGSQGRAHVTPADLIACAMRMRPDRVLLAELRGAEAYD
FLKLLTTGHAGSMTSFHASSTGIAIERFALMAKEHPEAAAWNIASLKRVLRLTIDVIAHMEAQPVLDSHG
VQVGKRWAMTEVWFDPREKAAIEFDPTERYCDG
 
Nucleotide Sequence: 1152 bp     [Download]
>gi|170735571|ref|NC_010515.1|:c1130457-1129306 Burkholderia cenocepacia MC0-3 chromosome 2, complete sequence
ATGAAGGCGTTCGAGGCAACACTTCAGCCGCAAACTGATCGCGTAGCCGATACGATGTCGGTATTACCCG
ATGATGCATCGGTGACGGAGCTGATGCGTTCATTCGCACCGTTGCTCGCCGACGAAGCCGTAACGGAGCT
CGTGATCAACCGACCGCAGCGTATTCTGACCGAAACCCATCGGGGGTGGCAGGCACACGATTTACCAGAA
CTTGATTTCGAACGACTCATGGCGTTCGCCGTGGCGATTGCTACATTGACGAATCAGAGCGTCTCGACCG
AGCATCCGCTGCTTTCCGCACTGTTACCGGACAACGCGCGTCTCCAACTCGCGGTGCCGCCCGTGGTGCC
GTCGCGGACGGTATCGGTCACGATCAGGCGCCCGAGCGCGGATGAAAAGACGCTCGAGTGCCATCGCGCC
GACGGCATGTTTGAGGACACGGTTTGGCGACACGTAAGCGGTCTAGGCAAGACCGGCCAAGCGTTGCGCG
CAGTCGATCGGATGCTCGTTGAGCAGCTTGAAGCGCGTGATTTTGCCGCCTTCTTCGAAGGCGCCGTGCG
AGCACACCGCAATATTGTCATTGTCGGCAGCACGGGCTCCGGCAAGACGAGCTTTATGCGCAGCTTGTGC
CGATACCTGGGAGCAACCGAGCGCATCGTGACGATCGAAGACGTACGCGAGCTGTTCATTCGGCATGTCG
AAAACTGCGTCCATCTTCTCTATAGCAAAGGTTCGCAGGGACGCGCACACGTAACGCCTGCAGATTTGAT
TGCCTGCGCCATGCGCATGCGCCCCGACCGGGTGTTGCTTGCCGAGCTCCGAGGGGCGGAAGCGTACGAC
TTCCTGAAACTCTTGACAACGGGGCATGCCGGCTCGATGACGAGTTTTCATGCGTCCAGTACGGGCATTG
CCATCGAGCGGTTTGCGCTCATGGCAAAGGAGCATCCGGAGGCAGCCGCTTGGAACATTGCTTCGCTCAA
GCGTGTGCTGCGCTTGACCATCGACGTGATCGCTCACATGGAGGCGCAGCCCGTATTGGACTCGCACGGT
GTGCAGGTCGGCAAACGCTGGGCGATGACCGAAGTCTGGTTCGACCCGCGCGAGAAGGCCGCTATCGAGT
TTGACCCAACCGAGAGGTACTGCGATGGATGA
 Primer design