SecReT4
Protein ID: 170736576
T4SS name [ID]VirB [205]
Gene symbol-
Locus tagBcenmc03_4195
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome 2 [GenBank: NC_010515] [Browse all T4SS(s) in this replicon]
Location [Strand]1130454..1131677 [-]
Productconjugation TrbI family protein
Component typeVirB10
UniProt IDB1K7J3
KEGG IDbcm:Bcenmc03_4195
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.6e-53, Aligned region: 219..395
Protein Sequence: 407 a.a.     [Download]
>gi|170736576|ref|YP_001777836.1| conjugation TrbI family protein [Burkholderia cenocepacia MC0-3]
MTEDTSPNGAATDDEIRRNSPADMNTGMGSESSVMLDRGMPSLDGFGRRSFINWLVPLTIIVLALIGAVW
TVHGVLAHRDEAARARRSALHARGAHEKVFDEVPALAESASAAAMPTPTPAPAAVQPVPSSDRAAPLRSY
YDAPLLAVGASNGQMADASESESASPSILPAHADQQQSNATAGMAEERAKPFSQPLSQALTPTRVPTVIA
AFIGNRSLLLAQGTKIDCAGDTAFDSTQAGISTCTVARNVYSDDGRVVLIERGSQINCEYRANLSPGQRR
VFVLSARIATPHGVTVQIDSPVADALGRMGMDGSIENHWGARVGAAMMLGLSHDAIGYLATRGGNGNGTI
VYQNTQAQGNDMATRVLDQTINIAPTLRQHQGTEFTIVLARDLDFSSVYTLEPEGVR
 
Nucleotide Sequence: 1224 bp     [Download]
>gi|170735571|ref|NC_010515.1|:c1131677-1130454 Burkholderia cenocepacia MC0-3 chromosome 2, complete sequence
ATGACTGAGGACACTTCGCCCAACGGCGCAGCGACGGACGACGAGATTCGTCGCAACAGCCCGGCAGATA
TGAACACGGGTATGGGGTCCGAATCGTCTGTCATGCTCGATCGCGGCATGCCCAGCCTGGATGGGTTCGG
GCGACGATCGTTCATCAACTGGCTAGTACCGCTCACGATCATCGTACTTGCGCTAATAGGCGCGGTCTGG
ACAGTTCATGGTGTGCTCGCTCACCGAGACGAGGCTGCGCGTGCGCGCCGCAGTGCGCTCCATGCGCGAG
GCGCACACGAAAAGGTGTTCGACGAGGTGCCGGCACTTGCCGAGTCTGCGTCGGCCGCTGCAATGCCCAC
ACCGACGCCAGCACCGGCCGCGGTACAGCCTGTGCCGTCCAGTGATCGTGCTGCTCCGTTACGCAGCTAC
TACGACGCGCCGTTGCTCGCCGTGGGGGCGAGCAACGGGCAAATGGCAGACGCGAGCGAGAGTGAGTCAG
CTTCCCCCAGTATTTTGCCCGCGCACGCGGACCAGCAGCAGTCGAATGCGACTGCCGGTATGGCCGAGGA
GCGGGCGAAACCCTTCTCACAGCCGCTGTCTCAGGCGCTCACGCCGACGCGCGTGCCCACGGTGATAGCG
GCGTTTATCGGCAACCGCAGTTTGCTACTCGCTCAGGGCACGAAGATCGATTGCGCGGGCGACACCGCGT
TCGATTCCACCCAGGCAGGTATATCGACTTGCACGGTCGCCCGTAATGTCTATTCCGACGACGGGCGCGT
GGTGCTGATCGAGCGAGGCTCGCAAATTAATTGCGAATATCGCGCGAATCTTTCACCTGGACAACGACGT
GTATTTGTTCTGTCAGCACGAATTGCTACACCGCACGGTGTCACTGTACAGATCGATTCGCCGGTAGCCG
ACGCGCTGGGCCGCATGGGTATGGATGGATCGATCGAGAATCACTGGGGCGCGCGCGTGGGCGCGGCCAT
GATGCTCGGACTAAGTCACGATGCGATCGGTTATCTGGCCACGCGCGGGGGCAATGGCAACGGCACGATT
GTCTACCAGAACACGCAGGCGCAAGGCAACGACATGGCCACACGCGTACTCGATCAGACCATCAATATTG
CGCCGACGCTCAGGCAACATCAGGGTACCGAGTTCACGATTGTTCTGGCTCGCGATCTGGATTTCAGTTC
GGTCTATACGCTGGAGCCGGAGGGAGTGCGATGA
 Primer design