SecReT4
Protein ID: 170736577
T4SS name [ID]VirB [205]
Gene symbol-
Locus tagBcenmc03_4196
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome 2 [GenBank: NC_010515] [Browse all T4SS(s) in this replicon]
Location [Strand]1131670..1132494 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeVirB9
UniProt IDB1K7J4
KEGG IDbcm:Bcenmc03_4196
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7.1e-57, Aligned region: 30..246
Protein Sequence: 274 a.a.     [Download]
>gi|170736577|ref|YP_001777837.1| conjugal transfer protein TrbG/VirB9/CagX [Burkholderia cenocepacia MC0-3]
MNTLATMAILLACFAAQAVDAHITPDWTRDARVRKVRYVPDEVVRIFAQRGFATHVELDPTEHILVVAPG
DRDGWYVVANRGDHDVYLKPKLAAHDTNLIVRTDRRSYSFDLLVLPLKERFGNAHEMYRVSFVYPDTAAS
DVSIAARLACLQKRLSQPSVVRNAAYSMQVMPHAEDIAPSAVWDDGRFTYIRIPNNRRIPAIFQVEDDDT
ERVVDKHMDRDVVVVHELARRLVLRLGDEAVGLWNDAFDIDGVAPQHGVTVDGVRRTLRSREHD
 
Nucleotide Sequence: 825 bp     [Download]
>gi|170735571|ref|NC_010515.1|:c1132494-1131670 Burkholderia cenocepacia MC0-3 chromosome 2, complete sequence
ATGAATACGCTCGCGACCATGGCGATCCTATTAGCGTGCTTTGCGGCGCAAGCGGTCGATGCCCACATCA
CGCCGGACTGGACGCGCGATGCCAGGGTGCGCAAAGTGCGTTATGTGCCTGACGAAGTCGTGCGCATTTT
CGCGCAGCGCGGCTTTGCCACCCACGTCGAGCTGGATCCGACCGAGCACATTCTCGTGGTTGCGCCAGGG
GACCGCGATGGCTGGTATGTGGTAGCCAATCGGGGAGACCATGACGTCTATCTGAAGCCGAAACTCGCCG
CTCATGACACGAATCTCATTGTCCGGACCGATCGGCGCAGCTACAGCTTTGACCTTCTCGTTTTGCCCCT
GAAAGAACGCTTTGGCAACGCGCACGAGATGTACCGGGTAAGTTTCGTGTACCCGGACACTGCTGCGTCG
GATGTATCTATTGCCGCGCGCTTGGCGTGTTTGCAGAAACGGCTGTCTCAGCCGTCTGTCGTGCGTAACG
CCGCGTACTCGATGCAGGTCATGCCACATGCCGAGGATATCGCACCGTCCGCAGTATGGGACGACGGTCG
CTTTACGTACATTCGAATCCCCAACAATCGCCGTATACCCGCGATCTTCCAAGTTGAGGACGATGACACC
GAACGCGTGGTGGACAAGCACATGGACCGTGATGTGGTGGTCGTCCATGAGCTTGCCCGCCGACTCGTGT
TGCGTCTGGGCGATGAGGCGGTTGGTTTGTGGAACGACGCATTCGACATTGATGGTGTCGCGCCGCAGCA
CGGTGTGACGGTCGACGGCGTGCGCCGCACGCTGCGGAGTCGCGAACATGACTGA
 Primer design