SecReT4
Protein ID: 170736578
T4SS name [ID]VirB [205]
Gene symbol-
Locus tagBcenmc03_4197
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome 2 [GenBank: NC_010515] [Browse all T4SS(s) in this replicon]
Location [Strand]1132491..1133195 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDB1K7J5
KEGG IDbcm:Bcenmc03_4197
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.7e-49, Aligned region: 10..220
Protein Sequence: 234 a.a.     [Download]
>gi|170736578|ref|YP_001777838.1| VirB8 family protein [Burkholderia cenocepacia MC0-3]
MNDQSDYRRALDFEASLTALQACSERRAWQVAFAAVIVAIGSAAALAVMTPFYRVVPLPIEVNKLTGEAQ
LIEVLDAKHVPLREIEDKHWVEVYVRARERYDWGLLQMDYDRVLEMSDESVARAYRQIYSGPNALDQQLG
ASVQYRTRIVSTTLVPDEPGHAVVHLERTVRKNGIDTGEPAKRFVITLAFTYRPTVLVRERSAIENPFGF
KVTAYSRDAEDTPPAPQPSAGAGR
 
Nucleotide Sequence: 705 bp     [Download]
>gi|170735571|ref|NC_010515.1|:c1133195-1132491 Burkholderia cenocepacia MC0-3 chromosome 2, complete sequence
GTGAACGATCAAAGCGATTATCGACGTGCGCTTGATTTTGAGGCGTCGCTCACCGCGTTGCAGGCATGCT
CCGAGCGTCGTGCATGGCAAGTGGCGTTTGCCGCCGTTATTGTTGCGATCGGTTCGGCAGCGGCGCTTGC
CGTGATGACGCCGTTTTATCGCGTGGTGCCATTGCCTATCGAGGTGAACAAACTCACCGGCGAGGCGCAA
CTCATTGAGGTGCTCGACGCAAAACACGTGCCACTGCGTGAGATCGAAGACAAGCACTGGGTCGAAGTCT
ATGTACGCGCTCGCGAGCGCTACGACTGGGGACTGTTGCAAATGGATTACGACCGTGTCCTGGAGATGAG
CGACGAATCGGTCGCGCGCGCGTATCGTCAAATCTACAGCGGTCCGAACGCGTTGGATCAGCAACTGGGC
GCGTCAGTTCAATACCGCACCCGAATAGTATCGACGACGCTCGTGCCCGACGAGCCGGGACATGCTGTCG
TGCATCTGGAGCGCACGGTGCGCAAGAACGGCATCGATACCGGTGAGCCAGCAAAACGTTTTGTGATTAC
GCTCGCCTTTACCTACCGCCCCACGGTGCTGGTGCGGGAACGTTCGGCCATCGAAAATCCATTCGGCTTC
AAGGTGACGGCGTACAGCCGAGATGCGGAGGATACGCCACCTGCTCCACAGCCCAGTGCAGGAGCGGGCC
GATGA
 Primer design