SecReT4
Protein ID: 170736579
T4SS name [ID]VirB [205]
Gene symbol-
Locus tagBcenmc03_4198
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome 2 [GenBank: NC_010515] [Browse all T4SS(s) in this replicon]
Location [Strand]1133377..1134087 [-]
ProductP-type DNA transfer protein VirB5
Component typeVirB5
UniProt IDB1K7J6
KEGG IDbcm:Bcenmc03_4198
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.1e-58, Aligned region: 36..213
Protein Sequence: 236 a.a.     [Download]
>gi|170736579|ref|YP_001777839.1| P-type DNA transfer protein VirB5 [Burkholderia cenocepacia MC0-3]
MKRYLFTHIVLLSAVVAGAASFIEPVNAEIYSVYDEKNVAQAIAMVGQLKQQVQQEMALYRSLSGARGFG
ALLDRPGVVNALPDNWQSVYAAIREGGYAGLTGPAQALRAQSKLYDCEDQQGIDQRICQRALNKPFQDKA
LGLQAYQTELAELDRIELLMRHIDTTRDPKGIAELQARIQSESVAVGNEMTKLQMFKMLAETEDRLIAEQ
QTELLLKRAGNTRRLQDQMAPVTFGR
 
Nucleotide Sequence: 711 bp     [Download]
>gi|170735571|ref|NC_010515.1|:c1134087-1133377 Burkholderia cenocepacia MC0-3 chromosome 2, complete sequence
ATGAAGCGATACCTATTCACGCATATCGTACTGTTGAGCGCCGTTGTCGCGGGTGCGGCGTCTTTTATTG
AGCCGGTGAATGCGGAAATCTATTCGGTCTATGACGAAAAGAACGTCGCTCAGGCGATCGCGATGGTCGG
GCAGCTCAAACAACAAGTGCAGCAGGAGATGGCGTTGTACCGCTCGCTGAGCGGCGCGCGCGGCTTTGGT
GCGTTGCTGGATCGACCGGGGGTGGTCAATGCGCTGCCGGACAATTGGCAGAGCGTGTATGCCGCGATTC
GCGAGGGTGGGTATGCCGGGTTGACTGGTCCGGCTCAGGCACTGCGCGCGCAAAGCAAGCTCTACGACTG
TGAAGACCAGCAGGGCATCGATCAGCGAATTTGCCAGCGCGCGTTAAACAAGCCATTTCAAGATAAGGCG
CTTGGTCTGCAGGCATATCAGACCGAGCTTGCCGAACTTGACCGGATTGAACTTCTGATGCGGCACATCG
ACACGACACGGGATCCGAAGGGTATCGCGGAACTGCAAGCACGAATCCAGTCGGAGAGTGTGGCAGTCGG
CAACGAAATGACGAAGTTGCAGATGTTCAAGATGCTCGCGGAAACCGAGGATCGCTTGATTGCCGAGCAG
CAGACTGAACTGCTCCTCAAGCGAGCGGGCAACACGCGTCGACTCCAGGATCAGATGGCGCCGGTCACGT
TTGGCCGATAA
 Primer design