SecReT4
Protein ID: 170736580
T4SS name [ID]VirB [205]
Gene symbol-
Locus tagBcenmc03_4199
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome 2 [GenBank: NC_010515] [Browse all T4SS(s) in this replicon]
Location [Strand]1134103..1135254 [-]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeVirB6
UniProt IDB1K7J7
KEGG IDbcm:Bcenmc03_4199
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-32, Aligned region: 39..311
Protein Sequence: 383 a.a.     [Download]
>gi|170736580|ref|YP_001777840.1| TrbL/VirB6 plasmid conjugal transfer protein [Burkholderia cenocepacia MC0-3]
MNGLFSAVGGTLENGMHTYVSDASSALSSALVPGATTGAVIWVLAYGMAVIRGEAHESVPAFAWRGMKVV
ITLAFALSAGLYQSQVVTAVSETTTGVAQAIQTAAVRTGAGNIGCGSVEQASEASEHAVSIYRTLDCYDR
QLNLVVDAYFDKATHEGLSMSGIVAGIGDLACGLVAAFGGAIFLMVLGVEVMMARMLLDLVLSLGPIFIA
CGAFSPTVRFFEAWTAKLVNYALLQVLVAAFLGLALAAFSANLAPFQVTTADPDASADALAAAARQALQA
SAPWAAAFGMFVTSVLLATIGWQLPAVASGLAGGATVSGFGAFVAGYASRQAAGAMAFALRSTNRSASSG
GRISRPGALVSTVSPHRPAYQRAAREQLDRALD
 
Nucleotide Sequence: 1152 bp     [Download]
>gi|170735571|ref|NC_010515.1|:c1135254-1134103 Burkholderia cenocepacia MC0-3 chromosome 2, complete sequence
ATGAATGGCCTCTTCAGCGCGGTGGGCGGTACGCTCGAAAATGGTATGCACACGTACGTGAGCGATGCAT
CGTCTGCGTTGTCGTCCGCGTTAGTACCCGGGGCTACCACGGGAGCGGTGATCTGGGTTCTCGCGTATGG
CATGGCAGTGATTCGCGGAGAGGCACACGAGTCGGTGCCGGCATTTGCGTGGCGAGGTATGAAAGTCGTC
ATCACGCTCGCATTTGCGCTAAGTGCGGGGCTGTACCAGTCGCAGGTCGTCACTGCCGTGAGCGAGACGA
CAACCGGCGTCGCGCAGGCAATTCAGACAGCAGCCGTTCGTACCGGCGCGGGAAATATTGGATGCGGGTC
GGTTGAACAAGCGAGCGAGGCAAGCGAGCATGCTGTGAGCATTTACCGGACGCTCGATTGCTATGATCGG
CAGCTTAACCTCGTGGTCGACGCCTATTTCGACAAGGCGACCCATGAAGGTCTGAGCATGAGCGGCATCG
TCGCAGGTATCGGCGACCTTGCTTGTGGTCTGGTTGCCGCCTTCGGGGGCGCAATCTTTCTGATGGTGCT
CGGCGTCGAGGTGATGATGGCGCGCATGCTGCTCGACCTCGTACTTTCGCTGGGTCCTATATTCATTGCG
TGTGGAGCATTTAGTCCTACTGTTCGCTTTTTCGAAGCATGGACTGCCAAGCTCGTGAACTATGCGCTGT
TGCAAGTGTTGGTTGCGGCTTTTCTTGGTCTCGCGCTCGCGGCGTTCTCGGCCAACCTCGCACCGTTTCA
AGTAACGACTGCTGATCCGGACGCTTCTGCCGATGCGTTGGCCGCTGCCGCCCGTCAAGCACTTCAAGCA
AGCGCCCCCTGGGCGGCGGCTTTCGGCATGTTTGTTACATCCGTGCTACTGGCGACGATTGGGTGGCAGT
TGCCGGCGGTGGCTTCGGGGCTTGCGGGCGGTGCGACTGTCTCGGGTTTTGGAGCGTTTGTCGCCGGCTA
CGCATCCAGACAGGCAGCCGGTGCGATGGCCTTCGCACTGCGCAGTACAAACCGAAGCGCATCTTCCGGC
GGTCGAATATCGAGGCCTGGCGCATTGGTGAGCACCGTCTCGCCGCATCGTCCCGCCTATCAACGGGCTG
CACGCGAGCAGCTTGACCGAGCACTCGACTGA
 Primer design