SecReT4
Protein ID: 170736581
T4SS name [ID]VirB [205]
Gene symbol-
Locus tagBcenmc03_4200
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome 2 [GenBank: NC_010515] [Browse all T4SS(s) in this replicon]
Location [Strand]1135251..1137731 [-]
Producttype IV secretion/conjugal transfer ATPase
Component typeVirB4
UniProt IDB1K7J8
KEGG IDbcm:Bcenmc03_4200
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 6.5e-48, Aligned region: 191..387
AAA_10 [PF12846], Evalue: 1.8e-24, Aligned region: 450..727
Protein Sequence: 826 a.a.     [Download]
>gi|170736581|ref|YP_001777841.1| type IV secretion/conjugal transfer ATPase [Burkholderia cenocepacia MC0-3]
MSTPSAHATLVPREVVLADFIPFSSHVTDRVIRTREGDYIQIWKVPGIAFETADPADILARHVTFNQLVR
NLPGGHVALWTHRLRRRTADRFETTYLNRFCQDLAERYYASFAGYTMMTNELYVSAVYRPHRTRLGRLFS
RAARRTPDAIQRDQQDALRALADIAAQIETGLKPWSPCALSVYERGDPLTKRPCRYSAALEMLGYLVNGT
WEPVPVGYGRICDTLPTSRLFFHREKLEIRTPTRTRYAALLDLKDYPEQTEPGMLNGLLYGDFEYIETQS
FTVLDRPSAKEALERQRNQLIAGDDVAVSQIEAMDQAANDLVNGDFVLGEYHYTLAVLGDTLDEVVRHVA
QARTKLADAGFQSALIDLVADAAWFAQCPGNWRYRPREAKLTSRNFCAMASLHNFATGKREGNPWGEAIT
IVKTPSGQPLYLNFHATPEKVDSNDEKALANTQIIGRAGAGKTVLELFLLAMTMKYGVMGVLFDKDRGAE
IGIRAMGGQYTVFHRGEPTGMNPFQLEVDEATHSFWIRLVCKLVDNGVPLSAKDELDISRAIREVARMDR
SLRRLSMVRQLLPNVGDNSLHARLAKWCAGGRLGWVLDNPIDRIDLDAHQLFGFDDTELLDDSEVCAPLT
MVLLHLTERLIDGRRFIYVMTEFWKRLRDPVFSEFANDKQKTIRKQNGLGIFDTQSPADVLSSPISRALV
EQTATFFFLPNPSADHDDYVHGFKLTEAEFNIVRRMGEHSRLFLVKQGHRSAVGRLDLSGLGDVLDVLSG
TSDNVALLNTIRAKVGDDPDVWLPRFHDALTARRRQTSAFQTALSSTATHVQGGVL
 
Nucleotide Sequence: 2481 bp     [Download]
>gi|170735571|ref|NC_010515.1|:c1137731-1135251 Burkholderia cenocepacia MC0-3 chromosome 2, complete sequence
ATGAGCACACCGTCGGCACATGCAACCCTCGTACCGCGCGAAGTGGTGCTCGCAGATTTCATCCCATTTT
CGTCGCACGTCACGGACCGCGTGATTCGCACGCGCGAAGGTGACTATATACAAATCTGGAAGGTCCCCGG
GATTGCTTTCGAGACGGCCGATCCTGCCGATATTCTCGCGCGTCATGTCACCTTCAATCAGTTGGTGCGC
AATCTGCCGGGTGGCCACGTCGCGCTATGGACGCATCGGCTTCGGCGGCGTACCGCGGACAGGTTCGAGA
CGACCTATCTCAACCGATTCTGTCAGGATTTGGCTGAGCGCTACTACGCGAGCTTTGCCGGTTACACGAT
GATGACCAACGAGCTTTACGTGAGCGCCGTATATCGCCCTCACCGGACGCGATTGGGGCGGCTGTTTAGT
CGTGCGGCACGCCGTACACCTGACGCTATTCAGCGCGATCAACAAGACGCATTGCGTGCGTTGGCCGATA
TCGCTGCGCAGATCGAGACTGGTCTCAAACCGTGGTCGCCGTGTGCGCTCAGCGTGTATGAACGCGGCGA
TCCATTGACCAAGCGGCCCTGTCGCTATTCCGCCGCGCTTGAAATGCTTGGCTACCTGGTTAACGGAACG
TGGGAGCCGGTACCGGTTGGATACGGTCGAATTTGCGACACGTTACCAACCTCGCGCCTGTTCTTCCACC
GTGAGAAGCTCGAGATCCGCACACCTACGCGTACCCGCTACGCGGCATTGCTCGACCTGAAGGACTATCC
GGAGCAAACCGAGCCAGGCATGCTCAATGGATTGCTCTACGGCGACTTCGAGTACATCGAAACGCAAAGC
TTTACCGTGCTCGACCGTCCCAGTGCCAAGGAGGCGCTCGAGCGGCAGCGCAACCAACTGATTGCGGGAG
ATGACGTTGCTGTCTCGCAGATCGAGGCAATGGATCAGGCCGCGAACGATCTCGTCAATGGCGATTTCGT
TTTGGGCGAGTACCACTACACGTTGGCCGTGCTGGGAGATACCTTGGATGAGGTAGTGCGGCATGTCGCT
CAAGCACGAACGAAGCTTGCAGACGCCGGCTTCCAGAGTGCGCTCATTGATCTGGTCGCCGATGCTGCGT
GGTTCGCGCAGTGCCCCGGCAACTGGCGATACCGACCGCGAGAGGCGAAGCTTACATCACGCAACTTTTG
CGCGATGGCCAGTTTGCACAACTTCGCGACTGGAAAGCGAGAGGGTAATCCGTGGGGCGAAGCTATCACG
ATTGTCAAAACGCCCAGCGGGCAACCGCTCTATCTGAACTTTCACGCAACGCCCGAGAAAGTCGACTCAA
ACGACGAGAAGGCGCTTGCCAACACGCAGATCATCGGCCGAGCCGGTGCAGGCAAGACTGTGCTTGAACT
GTTCCTGCTCGCGATGACAATGAAGTACGGTGTGATGGGCGTGCTCTTCGACAAGGACCGAGGAGCGGAA
ATCGGGATTCGCGCCATGGGTGGTCAGTACACGGTATTTCACCGTGGTGAGCCCACCGGCATGAACCCGT
TCCAGTTGGAAGTGGACGAGGCGACACACAGTTTTTGGATACGTCTCGTGTGCAAGCTGGTCGACAACGG
AGTACCACTGTCCGCGAAGGATGAGCTCGATATCTCTCGCGCGATCCGGGAGGTCGCACGCATGGATCGA
TCGCTGCGTCGGTTGTCCATGGTCAGGCAACTCTTGCCAAACGTTGGAGATAACAGTCTTCATGCGCGGC
TTGCCAAGTGGTGCGCCGGCGGGCGCCTCGGCTGGGTGCTCGATAACCCCATTGACCGGATTGATCTAGA
TGCGCACCAATTGTTCGGCTTTGACGATACAGAACTGCTCGACGATTCGGAGGTATGTGCGCCACTGACG
ATGGTGTTGCTGCATCTGACCGAACGCCTGATCGATGGGCGGCGTTTCATCTATGTGATGACCGAGTTCT
GGAAGCGCCTGCGCGATCCGGTGTTCAGCGAGTTTGCCAACGACAAGCAAAAGACCATTCGCAAGCAAAA
TGGCCTGGGTATCTTTGACACCCAGTCGCCTGCGGACGTGTTGAGCAGTCCGATCTCTCGTGCGCTTGTA
GAGCAGACGGCTACATTCTTCTTCCTCCCCAACCCTAGCGCAGACCACGATGATTATGTCCACGGTTTCA
AGCTGACCGAAGCAGAATTCAACATTGTGAGACGCATGGGTGAGCACAGTCGGCTGTTCTTGGTCAAGCA
GGGTCATCGTTCAGCAGTCGGGCGACTCGATCTCTCGGGATTGGGCGACGTGCTCGATGTCCTGTCGGGC
ACGTCAGACAATGTTGCGTTGCTCAATACGATCCGGGCCAAGGTCGGGGACGACCCCGATGTGTGGTTGC
CGCGCTTTCATGATGCCCTGACTGCTCGCCGGCGCCAAACGAGTGCGTTTCAAACCGCATTGTCGAGCAC
CGCTACACACGTGCAAGGTGGTGTTCTATGA
 Primer design