SecReT4
Protein ID: 170736582
T4SS name [ID]VirB [205]
Gene symbol-
Locus tagBcenmc03_4201
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome 2 [GenBank: NC_010515] [Browse all T4SS(s) in this replicon]
Location [Strand]1137733..1138053 [-]
Producttype IV secretory pathway VirB3 family protein
Component typeVirB3
UniProt IDB1K7J9
KEGG IDbcm:Bcenmc03_4201
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.3e-17, Aligned region: 3..94
Protein Sequence: 106 a.a.     [Download]
>gi|170736582|ref|YP_001777842.1| type IV secretory pathway VirB3 family protein [Burkholderia cenocepacia MC0-3]
MDTLSDPVFKGCTRPAMLWGVPLVPLLTVGGGMLIPAIWVLMASAALGVAIVLLIVPVFATMRMITRQDD
QRLAQRMLRAKMRLHQRNRRFWGAHAYAPIRFKARG
 
Nucleotide Sequence: 321 bp     [Download]
>gi|170735571|ref|NC_010515.1|:c1138053-1137733 Burkholderia cenocepacia MC0-3 chromosome 2, complete sequence
GTGGACACACTCTCTGATCCCGTATTCAAAGGCTGCACGCGGCCAGCGATGCTATGGGGCGTTCCACTTG
TACCGCTGTTGACGGTCGGTGGCGGTATGCTGATCCCGGCAATCTGGGTGTTGATGGCGAGTGCGGCTTT
GGGCGTTGCAATCGTACTGTTGATCGTTCCCGTGTTCGCGACGATGCGCATGATTACGCGTCAGGACGAC
CAACGTCTCGCTCAGCGCATGCTACGCGCGAAAATGAGACTGCACCAGCGCAACCGGCGCTTCTGGGGCG
CGCATGCCTATGCGCCGATCCGATTTAAGGCGCGAGGGTGA
 Primer design