SecReT4
Protein ID: 170736583
T4SS name [ID]VirB [205]
Gene symbol-
Locus tagBcenmc03_4202
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome 2 [GenBank: NC_010515] [Browse all T4SS(s) in this replicon]
Location [Strand]1138073..1138426 [-]
Productconjugal transfer protein TrbC
Component typeVirB2
UniProt IDB1K7K0
KEGG IDbcm:Bcenmc03_4202
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.7e-11, Aligned region: 26..113
Protein Sequence: 117 a.a.     [Download]
>gi|170736583|ref|YP_001777843.1| conjugal transfer protein TrbC [Burkholderia cenocepacia MC0-3]
MECIMKSVFLINISDLRLRKTCVAWISLNWRRIAVLSVLVMATPTASAQLSQVNTLLITIQNTLLGVGGV
VCSISIIWAGFKMMFQHARFGDIAHVFIGGLFVGCATVIAGMLIPTA
 
Nucleotide Sequence: 354 bp     [Download]
>gi|170735571|ref|NC_010515.1|:c1138426-1138073 Burkholderia cenocepacia MC0-3 chromosome 2, complete sequence
ATGGAGTGCATTATGAAATCTGTATTCCTAATTAATATAAGCGACTTGAGATTGAGAAAAACGTGTGTTG
CGTGGATCTCGTTGAATTGGCGCCGCATCGCAGTGCTCAGCGTGCTTGTCATGGCAACCCCCACGGCATC
TGCGCAACTCAGTCAGGTCAATACCTTGCTGATCACTATCCAGAACACGTTGCTAGGTGTGGGCGGGGTG
GTGTGTTCGATTTCCATCATCTGGGCCGGCTTCAAGATGATGTTCCAGCACGCCCGGTTTGGCGATATTG
CGCATGTTTTCATCGGCGGCCTTTTCGTTGGATGTGCAACGGTCATTGCTGGCATGTTGATTCCGACGGC
CTAA
 Primer design