SecReT4
Protein ID: 170736584
T4SS name [ID]VirB [205]
Gene symbol-
Locus tagBcenmc03_4203
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome 2 [GenBank: NC_010515] [Browse all T4SS(s) in this replicon]
Location [Strand]1138451..1139098 [-]
Productlytic transglycosylase catalytic
Component typeVirB1
UniProt IDB1K7K1
KEGG IDbcm:Bcenmc03_4203
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 2e-20, Aligned region: 9..147
Protein Sequence: 215 a.a.     [Download]
>gi|170736584|ref|YP_001777844.1| lytic transglycosylase catalytic [Burkholderia cenocepacia MC0-3]
MTTQDFVAMAQQCAPAVAPQTLAAIVRIESGFNPYAIGVVHGRLVRQPRREDEAIATVKALQAAGWNYSA
GLAQINRENWSRYGLTVGTVFDVCRNLSAGAAILRACFLRARVIHVHPQEALRAALSCYVSGNFVTGFRV
GYVRRITEAAASGDTFVPALTSVAKPIPVIPDRVTGSRAESRGRSTPVSPPPSNPNDDTARSQNNGGVAG
SAVIF
 
Nucleotide Sequence: 648 bp     [Download]
>gi|170735571|ref|NC_010515.1|:c1139098-1138451 Burkholderia cenocepacia MC0-3 chromosome 2, complete sequence
ATGACCACGCAAGACTTCGTGGCGATGGCTCAGCAGTGTGCGCCTGCTGTCGCCCCACAGACGTTGGCTG
CCATTGTACGAATCGAATCGGGATTCAATCCCTACGCTATCGGTGTTGTCCATGGCCGTTTGGTGAGACA
GCCTCGGCGCGAGGACGAAGCGATCGCCACGGTCAAGGCATTGCAAGCGGCAGGGTGGAACTACAGCGCC
GGCCTCGCGCAAATCAATCGCGAAAACTGGTCTCGTTACGGATTGACCGTGGGGACCGTCTTCGACGTCT
GTCGGAACCTGAGCGCTGGTGCGGCGATTCTTCGGGCATGTTTTCTGCGGGCTCGCGTCATTCATGTCCA
TCCACAAGAGGCGTTGCGCGCTGCGCTGTCGTGCTATGTGAGCGGGAATTTCGTAACCGGATTTCGCGTC
GGATATGTGCGACGGATTACGGAAGCAGCGGCGTCGGGCGACACTTTCGTCCCTGCGCTGACGTCAGTTG
CAAAGCCGATTCCGGTGATACCCGACCGTGTGACTGGGTCTCGGGCTGAGAGCCGCGGGCGCTCGACTCC
TGTGTCTCCTCCACCCTCGAACCCGAACGACGATACAGCGCGAAGCCAAAATAACGGTGGAGTCGCAGGC
AGTGCCGTGATCTTCTGA
 Primer design