SecReT4
Protein ID: 170745036
T4SS name [ID]VirB [374]
Gene symbol-
Locus tagMrad2831_6329
StrainMethylobacterium radiotolerans JCM 2831
Repliconplasmid pMRAD02 [GenBank: NC_010509] [Browse all T4SS(s) in this replicon]
Location [Strand]27186..27356 [+]
ProductTraI protein
Component typeVirB7
UniProt IDB1M9S6
KEGG IDmrd:Mrad2831_6329
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 56 a.a.     [Download]
>gi|170745036|ref|YP_001766494.1| TraI protein [Methylobacterium radiotolerans JCM 2831]
MKQCITLLCLVAMLAGCASNAAVVPALEGRARVPVNKQVPAQPPLTQQPTSSAQGE
 
Nucleotide Sequence: 171 bp     [Download]
>gi|170745005|ref|NC_010509.1|:27186-27356 Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence
ATGAAACAGTGCATTACCTTGCTTTGCCTTGTCGCCATGCTGGCGGGATGTGCAAGCAACGCAGCCGTCG
TCCCGGCACTAGAGGGACGCGCACGCGTGCCGGTGAACAAGCAGGTTCCGGCGCAGCCCCCGCTCACACA
GCAGCCGACCAGCTCGGCGCAGGGGGAATGA
 Primer design